Clone RH24252 Report

Search the DGRC for RH24252

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:242
Well:52
Vector:pFlc-1
Associated Gene/TranscriptCG42813-RA
Protein status:RH24252.pep: gold
Sequenced Size:983

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG42813-RA 2011-02-22 Manual selection by Sue Celniker

Clone Sequence Records

RH24252.complete Sequence

983 bp assembled on 2011-03-18

GenBank Submission: BT126160.1

> RH24252.complete
AACCAGGCAGTCAGCTGATTGCCACTGCCGTGTTTTCGTGCACCAAGTCC
ACTTTTTCAGCATGGAGAACGTTTCCAAGATTTGGCTGGGTCCCCTGCCC
CAGGATTCGCCGTACGTAAAGCCCTTCCGGCTGTACTACGTCCAGAATGG
CGTGGAGAAGAACTGGGACCTGCTGAAGGTCCACGATAGTGTGGCTATTA
TCTTGTACAACACTTCTCGCCAGAAACTGGTCCTGGTCCGCCAGTTCCGA
CCCGCCGTCTACCACGGCATCATCTCCAGCGCCAAGGGCACCTTCGATGA
GGTGGACCTCAAGGAGTTCCCGCCCGCCATCGGTGTCACCTTGGAACTGT
GCGCCGGCATCGTGGACAAAAACAAAAGCTGGGTGGAAATCGCTCGGGAG
GAAGTGGTCGAGGAGTGTGGCTACGATGTGCCCGTGGAACGCATTGAGGA
AGTCATGGTCTACAGATCTGGAGTTGGTTCATCGGGTGCCAAGCAGACCA
TGTACTACTGCGAGGTGACCGATGCGGACAAGGCCACAGGTGGTGGCGGC
GTCGACGACGAGATCATCGAGGTGGTGGAGCTGTCCCTGGAGGAGGCCAA
GCGGATGATCCAACAGGGAGCCGTCAACAACAGCCCGCCCAGCTGCCTGA
TGGGCCTGATGTGGTTCTTCGCCAACAGGGCACCCGGTGCGAAGGCCTAG
AGGCGAACGCTGTTGCTGTTGATTCACCCAGATAAGCGGCGGCCGTGATA
AGATGATAAGATGATAAGATGCGTCCGCATCCGCAGCGTTGCCTTATACA
CATCTTTTAGTCAACACCAACCATTTCGAATGCTTTCCAACCGAGCGCAT
TGTGAGTGCGCCTAGCGCACACGATATAATACTGAAATTCCCGTGCCTGT
CGAGGCTTACCTTATGATATGTATACCGTGTAATATGTAATAAACCCTGG
CCAGCTGTCCGCTCACGAAAAAAAAAAAAAAAA

RH24252.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23050366..23050868 965..463 2515 100 Minus
chr3R 27901430 chr3R 23050992..23051450 465..7 2295 100 Minus
chr3L 24539361 chr3L 15090523..15090704 644..463 685 91.8 Minus
chr3L 24539361 chr3L 15090317..15090470 963..811 480 89 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27227438..27227944 969..463 2520 99.8 Minus
3R 32079331 3R 27228068..27228526 465..7 2295 100 Minus
3L 28110227 3L 15100462..15100643 644..463 685 91.8 Minus
3L 28110227 3L 15100256..15100409 963..811 495 89.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26968269..26968775 969..463 2520 99.8 Minus
3R 31820162 3R 26968899..26969357 465..7 2295 100 Minus
3L 28103327 3L 15093562..15093743 644..463 685 91.7 Minus
3L 28103327 3L 15093356..15093509 963..811 505 89.6 Minus
Blast to na_te.dros performed on 2019-03-16 22:33:33 has no hits.

RH24252.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:34:14 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23050364..23050865 466..967 94 <- Minus
chr3R 23050992..23051450 7..465 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-22 17:53:27 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
CG42813-RA 1..639 62..700 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:58:08 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
CG42813-RA 1..639 62..700 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:30:25 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
CG42813-RB 1..639 62..700 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-22 17:53:27 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
CG42813-RA 1..957 11..967 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:58:08 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
CG42813-RA 1..957 11..967 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:30:25 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
CG42813-RB 36..996 7..967 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:14 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27227440..27227941 466..967 99 <- Minus
3R 27228068..27228526 7..465 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:14 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27227440..27227941 466..967 99 <- Minus
3R 27228068..27228526 7..465 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:14 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27227440..27227941 466..967 99 <- Minus
3R 27228068..27228526 7..465 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:58:08 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23053162..23053663 466..967 99 <- Minus
arm_3R 23053790..23054248 7..465 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:02:20 Download gff for RH24252.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26968271..26968772 466..967 99 <- Minus
3R 26968899..26969357 7..465 100   Minus

RH24252.pep Sequence

Translation from 1 to 699

> RH24252.pep
TRQSADCHCRVFVHQVHFFSMENVSKIWLGPLPQDSPYVKPFRLYYVQNG
VEKNWDLLKVHDSVAIILYNTSRQKLVLVRQFRPAVYHGIISSAKGTFDE
VDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECGYDVPVERIEE
VMVYRSGVGSSGAKQTMYYCEVTDADKATGGGGVDDEIIEVVELSLEEAK
RMIQQGAVNNSPPSCLMGLMWFFANRAPGAKA*

RH24252.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22943-PA 406 GF22943-PA 193..400 21..228 1032 89.4 Plus
Dana\GF22943-PA 406 GF22943-PA 1..191 32..220 561 55.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12132-PA 438 GG12132-PA 224..438 18..232 1113 97.2 Plus
Dere\GG12132-PA 438 GG12132-PA 27..225 24..220 612 55.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21306-PA 211 GH21306-PA 1..208 21..228 994 85.6 Plus
Dgri\GH21295-PA 228 GH21295-PA 20..227 21..226 599 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG42813-PA 212 CG31063-PA 1..212 21..232 1108 100 Plus
CG42813-PB 212 CG42813-PB 1..212 21..232 1108 100 Plus
CG42814-PA 237 CG31063-PA 27..233 24..228 641 54.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10493-PA 442 GI10493-PA 232..440 21..229 982 83.7 Plus
Dmoj\GI10493-PA 442 GI10493-PA 20..231 17..226 577 50.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23606-PA 1241 GL23606-PA 1028..1238 18..228 1042 86.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26653-PA 211 GA26653-PA 1..208 21..228 1000 86.5 Plus
Dpse\GA26652-PA 182 GA26652-PA 1..179 51..228 510 52 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10125-PA 404 GM10125-PA 190..404 18..232 1133 98.6 Plus
Dsec\GM10125-PA 404 GM10125-PA 1..191 32..220 565 52.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18086-PA 438 GD18086-PA 224..438 18..232 1125 98.1 Plus
Dsim\GD18086-PA 438 GD18086-PA 27..225 24..220 605 53.8 Plus
Dsim\GD12577-PA 81 GD12577-PA 43..78 175..210 140 80.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23175-PA 211 GJ23175-PA 1..210 21..230 1014 86.7 Plus
Dvir\GJ23174-PA 234 GJ23174-PA 22..233 17..226 609 51.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11191-PA 406 GK11191-PA 197..404 22..229 963 83.7 Plus
Dwil\GK11191-PA 406 GK11191-PA 17..224 20..225 511 46.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10580-PA 404 GE10580-PA 190..404 18..232 1124 98.1 Plus
Dyak\GE10580-PA 404 GE10580-PA 1..191 32..220 583 56 Plus

RH24252.hyp Sequence

Translation from 7 to 699

> RH24252.hyp
QSADCHCRVFVHQVHFFSMENVSKIWLGPLPQDSPYVKPFRLYYVQNGVE
KNWDLLKVHDSVAIILYNTSRQKLVLVRQFRPAVYHGIISSAKGTFDEVD
LKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECGYDVPVERIEEVM
VYRSGVGSSGAKQTMYYCEVTDADKATGGGGVDDEIIEVVELSLEEAKRM
IQQGAVNNSPPSCLMGLMWFFANRAPGAKA*

RH24252.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG42813-PA 212 CG31063-PA 1..212 19..230 1108 100 Plus
CG42813-PB 212 CG42813-PB 1..212 19..230 1108 100 Plus
CG42814-PA 237 CG31063-PA 27..233 22..226 641 54.6 Plus