Clone RH24570 Report

Search the DGRC for RH24570

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:245
Well:70
Vector:pFlc-1
Associated Gene/TranscriptCG31548-RA
Protein status:RH24570.pep: gold
Preliminary Size:1777
Sequenced Size:962

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31548 2002-10-17 Blastp of sequenced clone
CG31548 2003-01-01 Sim4 clustering to Release 3
CG31548 2008-04-29 Release 5.5 accounting
CG31548 2008-08-15 Release 5.9 accounting
CG31548 2008-12-18 5.12 accounting

Clone Sequence Records

RH24570.complete Sequence

962 bp (962 high quality bases) assembled on 2002-10-17

GenBank Submission: BT001792

> RH24570.complete
GACTGAGCTTGAGATCCCCTTACATAATTCTGGATCGGATCATGAATTTC
GCGGGCAAAGTGGTCCTTATTACGGGAGCAAGCTCCGGAATCGGAGCTGC
AACCGCCATTAAGTTTGCCAAGTACGGCGCCTGTCTGGCTCTCAATGGAC
GCAATGTGGAGAACCTGAAGAAGGTAGCCGCTGAGTGCAGCAAGGTGAGC
CAATCACAGCCGGCCCTGGTGGTGGGCGACATTGCCAAGGAGGCGGACAC
CCAGAGGATTTGGTCGGAAACCCTGCAGCAGTACGGCAAATTGGATGTGC
TGGTCAACAATGCCGGAATCATCGAGACGGGCACCATCGAGACGACTAGC
CTGGAGCAGTACGACCGCGTCATGAACACCAACCTGAGGGCAATCTACCA
CCTTACTATGCTGGCCACCCCCGAGCTGGTCAAGACCAAGGGCAACATCG
TGAACGTGTCCAGTGTCAATGGGATTCGCTCCTTCCCTGGCGTTCTGGCC
TACAACATATCCAAAATGGGAGTGGATCAGTTCACCCGCTGTGTGGCGTT
GGAGCTGGCTGCCAAGGGTGTGCGCGTGAACTGCGTGAATCCCGGCGTGA
CGGTCACCAATCTGCATGCCCGCGGCGGCATGGATGCGGAGACGTACAAA
AAGTTCCTGGAACACTCCAAGACCACCCATGCCTTGGGTCGTCCTGGAGA
TGTCAAGGAGGTGGCTGCGGCCATTGCCTTCCTGGCCAGCGATGAGGCCA
GCTTCAGCACTGGAGTCAGCCTGCCGGTGGACGGCGGTCGCCATGCCATG
TGCCCACGCTAATCCCACAGGACATGGAACTTTTAGTTTCCCCTGCATGG
ATTCTTCCATGAGTAAATGCATTTAATCCGATTTTTTTAATTGTTATTTT
GATTTACCTATTGTTTTGATTGTGTACATAAAACTGATTGCCATTTAAAA
AAAAAAAAAAAA

RH24570.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG31548-RA 946 CG31548-RA 1..946 2..947 4730 100 Plus
CG12171-RA 1017 CG12171-RA 681..835 651..805 535 89.6 Plus
CG31549-RA 1130 CG31549-RA 790..971 624..805 520 85.7 Plus
CG12171-RA 1017 CG12171-RA 327..514 297..484 340 78.7 Plus
CG31549-RA 1130 CG31549-RA 562..671 396..505 265 82.7 Plus
CG12171-RA 1017 CG12171-RA 552..628 522..598 250 88.3 Plus
CG31549-RA 1130 CG31549-RA 460..548 294..382 175 79.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1461559..1462503 946..2 4725 100 Minus
chr3R 27901430 chr3R 1459608..1460116 297..805 985 79.6 Plus
chr3R 27901430 chr3R 1458309..1458820 294..805 880 78.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5635900..5636845 947..2 4730 100 Minus
3R 32079331 3R 5633950..5634458 297..805 985 79.6 Plus
3R 32079331 3R 5632651..5633162 294..805 880 78.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5376731..5377676 947..2 4730 100 Minus
3R 31820162 3R 5375135..5375289 651..805 535 89.6 Plus
3R 31820162 3R 5373812..5373993 624..805 520 85.7 Plus
3R 31820162 3R 5374781..5374968 297..484 340 78.7 Plus
3R 31820162 3R 5373584..5373693 396..505 265 82.7 Plus
3R 31820162 3R 5375006..5375082 522..598 250 88.3 Plus
3R 31820162 3R 5373482..5373570 294..382 175 79.7 Plus
3R 31820162 3R 5375627..5375706 784..705 160 80 Minus
3R 31820162 3R 5375795..5375915 616..496 140 74.3 Minus
Blast to na_te.dros performed 2019-03-15 20:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
McClintock 6450 McClintock McCLINTOCK 6450bp 1116..1202 939..853 129 65.6 Minus

RH24570.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:26:45 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1461559..1462503 1..946 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:43:44 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 1..771 42..812 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:10:41 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 1..771 42..812 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:17 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 1..771 42..812 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:01:32 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 1..771 42..812 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:50 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 1..771 42..812 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:32:06 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 1..945 2..946 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:10:41 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 1..945 2..946 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:17 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 6..952 1..946 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:01:32 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 1..945 2..946 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:50 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
CG31548-RA 6..952 1..946 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:45 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5635901..5636845 1..946 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:45 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5635901..5636845 1..946 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:45 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5635901..5636845 1..946 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:17 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1461623..1462567 1..946 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:33:11 Download gff for RH24570.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5376732..5377676 1..946 99   Minus

RH24570.hyp Sequence

Translation from 2 to 811

> RH24570.hyp
LSLRSPYIILDRIMNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGR
NVENLKKVAAECSKVSQSQPALVVGDIAKEADTQRIWSETLQQYGKLDVL
VNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTKGNIV
NVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVT
VTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEAS
FSTGVSLPVDGGRHAMCPR*

RH24570.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG31548-PA 256 CG31548-PA 1..256 14..269 1295 100 Plus
CG31549-PB 257 CG31549-PB 3..257 15..269 914 69 Plus
CG31549-PA 257 CG31549-PA 3..257 15..269 914 69 Plus
CG12171-PA 257 CG12171-PA 3..257 15..269 901 68.6 Plus
CG31546-PA 264 CG31546-PA 9..264 14..269 716 57.6 Plus

RH24570.pep Sequence

Translation from 41 to 811

> RH24570.pep
MNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECS
KVSQSQPALVVGDIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIE
TTSLEQYDRVMNTNLRAIYHLTMLATPELVKTKGNIVNVSSVNGIRSFPG
VLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGGMDAE
TYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGR
HAMCPR*

RH24570.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18656-PA 256 GF18656-PA 1..256 1..256 1299 94.5 Plus
Dana\GF16339-PA 257 GF16339-PA 4..257 3..256 963 71.3 Plus
Dana\GF16338-PA 257 GF16338-PA 4..257 3..256 950 69.7 Plus
Dana\GF22046-PA 251 GF22046-PA 1..251 1..256 643 50.8 Plus
Dana\GF18657-PA 264 GF18657-PA 9..263 1..255 608 49.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10914-PA 256 GG10914-PA 1..256 1..256 1336 97.3 Plus
Dere\GG12965-PA 257 GG12965-PA 3..257 2..256 950 68.6 Plus
Dere\GG12970-PA 257 GG12970-PA 3..257 2..256 949 69.4 Plus
Dere\GG12728-PA 251 GG12728-PA 1..251 1..256 657 52.7 Plus
Dere\GG10919-PA 264 GG10919-PA 9..264 1..256 640 56 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17517-PA 257 GH17517-PA 1..257 1..256 1097 79.8 Plus
Dgri\GH22973-PA 257 GH22973-PA 3..257 2..256 970 72.2 Plus
Dgri\GH22984-PA 257 GH22984-PA 3..257 2..256 936 69.4 Plus
Dgri\GH17658-PA 242 GH17658-PA 4..238 2..249 312 34.7 Plus
Dgri\GH15276-PA 325 GH15276-PA 77..320 3..249 309 31.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG31548-PA 256 CG31548-PA 1..256 1..256 1295 100 Plus
CG31549-PB 257 CG31549-PB 3..257 2..256 914 69 Plus
CG31549-PA 257 CG31549-PA 3..257 2..256 914 69 Plus
CG12171-PA 257 CG12171-PA 3..257 2..256 901 68.6 Plus
CG31546-PA 264 CG31546-PA 9..264 1..256 716 57.6 Plus
CG3699-PA 251 CG3699-PA 1..251 1..256 636 51.6 Plus
CG10672-PA 317 CG10672-PA 70..315 4..252 306 31.5 Plus
CG7322-PC 242 CG7322-PC 4..238 2..249 295 32.7 Plus
CG7322-PB 242 CG7322-PB 4..238 2..249 295 32.7 Plus
CG7322-PA 242 CG7322-PA 4..238 2..249 295 32.7 Plus
CG3603-PB 249 CG3603-PB 7..247 4..249 272 32.8 Plus
CG3603-PA 249 CG3603-PA 7..247 4..249 272 32.8 Plus
CG7601-PA 326 CG7601-PA 53..243 5..191 232 32.5 Plus
Pdh-PD 260 CG4899-PD 1..188 1..191 194 29 Plus
Pdh-PB 277 CG4899-PB 18..205 1..191 194 29 Plus
Mfe2-PB 598 CG3415-PB 8..197 1..184 194 28.4 Plus
Mfe2-PA 598 CG3415-PA 8..197 1..184 194 28.4 Plus
CG31937-PA 321 CG31937-PA 46..237 5..190 189 29.4 Plus
CG17121-PA 361 CG17121-PA 91..260 4..172 187 25.3 Plus
Pdh-PC 261 CG4899-PC 1..189 1..191 186 27.4 Plus
Pdh-PA 278 CG4899-PA 18..206 1..191 186 27.4 Plus
CG40486-PC 247 CG40486-PC 7..207 6..195 185 28.4 Plus
CG40486-PB 247 CG40486-PB 7..207 6..195 185 28.4 Plus
CG13284-PE 325 CG13284-PE 56..246 5..193 185 27.3 Plus
CG13284-PA 325 CG13284-PA 56..246 5..193 185 27.3 Plus
CG2064-PA 330 CG2064-PA 43..241 5..191 185 29.2 Plus
CG13284-PC 338 CG13284-PC 69..259 5..193 185 27.3 Plus
CG13284-PD 339 CG13284-PD 70..260 5..193 185 27.3 Plus
CG13284-PB 339 CG13284-PB 70..260 5..193 185 27.3 Plus
CG5590-PA 412 CG5590-PA 8..201 4..188 184 26.8 Plus
scu-PA 255 CG7113-PA 6..254 7..253 183 28.4 Plus
CG7675-PE 287 CG7675-PE 3..197 5..186 181 30.6 Plus
CG7675-PC 287 CG7675-PC 3..197 5..186 181 30.6 Plus
CG7675-PA 287 CG7675-PA 3..197 5..186 181 30.6 Plus
CG31809-PC 316 CG31809-PC 48..237 5..193 181 27.7 Plus
CG31809-PB 316 CG31809-PB 48..237 5..193 181 27.7 Plus
CG31810-PA 324 CG31810-PA 56..245 5..193 181 27.7 Plus
CG7675-PD 336 CG7675-PD 52..246 5..186 181 30.6 Plus
CG7675-PB 336 CG7675-PB 52..246 5..186 181 30.6 Plus
CG40485-PC 247 CG40485-PC 8..203 7..191 179 25 Plus
CG40485-PB 247 CG40485-PB 8..203 7..191 179 25 Plus
antdh-PA 250 CG1386-PA 7..203 6..191 179 26.9 Plus
CG2065-PB 300 CG2065-PB 14..221 5..208 179 29.2 Plus
CG2065-PA 300 CG2065-PA 14..221 5..208 179 29.2 Plus
CG13833-PA 321 CG13833-PA 49..241 2..190 178 25.4 Plus
CG2070-PB 325 CG2070-PB 40..241 2..191 169 26.5 Plus
CG2070-PA 325 CG2070-PA 40..241 2..191 169 26.5 Plus
CG40485-PA 231 CG40485-PA 8..147 7..144 168 26.4 Plus
CG6012-PA 308 CG6012-PA 49..239 5..193 164 28 Plus
firl-PE 318 CG14946-PE 54..246 4..191 164 26.5 Plus
CG18814-PB 267 CG18814-PB 63..222 63..226 163 31.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22521-PA 256 GI22521-PA 1..256 1..256 1188 85.9 Plus
Dmoj\GI10241-PA 257 GI10241-PA 3..257 2..256 945 69.8 Plus
Dmoj\GI10240-PA 257 GI10240-PA 4..257 3..256 904 70.1 Plus
Dmoj\GI14997-PA 255 GI14997-PA 1..255 1..256 663 52.5 Plus
Dmoj\GI11985-PA 329 GI11985-PA 81..327 3..252 310 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23021-PA 256 GL23021-PA 1..256 1..256 1150 81.6 Plus
Dper\GL24511-PA 257 GL24511-PA 4..257 3..256 972 71.3 Plus
Dper\GL24510-PA 257 GL24510-PA 4..257 3..256 929 69 Plus
Dper\GL14417-PA 255 GL14417-PA 1..255 1..256 640 49.8 Plus
Dper\GL21318-PA 350 GL21318-PA 112..346 2..249 298 33.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16317-PA 256 GA16317-PA 1..256 1..256 1157 82.4 Plus
Dpse\GA11451-PA 257 GA11451-PA 4..257 3..256 983 72 Plus
Dpse\GA27306-PA 257 GA27306-PA 4..257 3..256 926 68.6 Plus
Dpse\GA17622-PA 255 GA17622-PA 1..255 1..256 640 49.8 Plus
Dpse\GA10483-PA 319 GA10483-PA 71..317 3..252 303 31 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10606-PA 256 GM10606-PA 1..256 1..256 1357 99.6 Plus
Dsec\GM10826-PA 257 GM10826-PA 3..257 2..256 958 70.2 Plus
Dsec\GM10825-PA 257 GM10825-PA 3..257 2..256 956 69.4 Plus
Dsec\GM10607-PA 264 GM10607-PA 9..264 1..256 659 58 Plus
Dsec\GM19006-PA 251 GM19006-PA 1..251 1..256 656 51.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19595-PA 256 GD19595-PA 1..256 1..256 1357 99.6 Plus
Dsim\GD19803-PA 257 GD19803-PA 3..257 2..256 948 69.4 Plus
Dsim\GD19596-PA 264 GD19596-PA 9..264 1..256 659 58 Plus
Dsim\GD16445-PA 251 GD16445-PA 1..251 1..256 656 51.6 Plus
Dsim\GD19802-PA 1449 GD19802-PA 1353..1449 160..256 452 83.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10125-PA 255 GJ10125-PA 1..255 1..256 1198 87.9 Plus
Dvir\GJ10124-PA 255 GJ10124-PA 1..255 1..256 1122 81.6 Plus
Dvir\GJ11045-PA 257 GJ11045-PA 3..257 2..256 939 70.2 Plus
Dvir\GJ11044-PA 257 GJ11044-PA 4..257 3..256 882 70.1 Plus
Dvir\GJ15354-PA 255 GJ15354-PA 1..255 1..256 685 55.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13365-PA 256 GK13365-PA 1..256 1..256 1136 86.7 Plus
Dwil\GK13927-PA 257 GK13927-PA 4..257 3..256 973 70.9 Plus
Dwil\GK13928-PA 257 GK13928-PA 3..257 2..256 962 71.1 Plus
Dwil\GK10169-PA 255 GK10169-PA 1..255 1..256 649 50.6 Plus
Dwil\GK20088-PA 242 GK20088-PA 4..238 2..249 315 34.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24152-PA 256 GE24152-PA 1..256 1..256 1322 96.9 Plus
Dyak\GE10147-PA 257 GE10147-PA 3..257 2..256 949 69.4 Plus
Dyak\GE10146-PA 257 GE10146-PA 3..257 2..256 934 67.1 Plus
Dyak\GE16554-PA 251 GE16554-PA 1..251 1..256 650 51.6 Plus
Dyak\GE24153-PA 264 GE24153-PA 9..264 1..256 645 56.8 Plus