Clone RH24988 Report

Search the DGRC for RH24988

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:249
Well:88
Vector:pFlc-1
Associated Gene/TranscriptCG7714-RA
Protein status:RH24988.pep: gold
Preliminary Size:758
Sequenced Size:970

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7714 2001-12-17 Blastp of sequenced clone
CG7714 2002-01-01 Sim4 clustering to Release 2
CG7714 2003-01-01 Sim4 clustering to Release 3
CG7714 2008-04-29 Release 5.5 accounting
CG7714 2008-08-15 Release 5.9 accounting
CG7714 2008-12-18 5.12 accounting

Clone Sequence Records

RH24988.complete Sequence

970 bp (970 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071711

> RH24988.complete
GATCAGTGATCGGTGAGCCGAGTTAGCAGCCAGACGCATTCCTTCTCCAG
TCTTGCAAGTAACCCGAAAATCAAACCATCAACATGAAAGCCGTGATCTT
TGTGCTCGCCGTCGTGGTAGCCATGGCCGGAAAAGCCCACGCCGCATGCT
CCGCCGTTCCTCAATATACGGAAAAGATCGATCCTGTCAATTGCCCACAG
TCAGGATTCAAGTTGCCCAACTATGAGAACGCCTCCGTGTACTACCAGTG
CACCGCACAGTTACAGTCCGATGGCAGCATAGTGGTGACTGGCGTCTTGA
CCAGCTGCGGTGAAGACACCTACTTCAACTATGCCTTGCAGAGATGCGTG
GCCTGCGCCAATTACTTCCCAAGCGCCCAGTGCAGCAGTCTGCCCATCAA
TGTGACCTGTGTGCCCATCTCCACCGTTACCACTGTGGCCCCCACAACCG
GAACCACCATTGCTCCCACCACCGCGTCCCCCACTACCGCTGCTTCCACC
ACTGCGGCACCTGGCGAGTCCACCACTGCAGCACCTGGCGAGTCTACCAC
CGTCACGGTGCCCGTACCACCAACTGAAGCTCCTGGCAGCACCACGGCCT
CCGGCAGTGACGACATCATTACCCCGACTGGTACCACCATCTCCGTGCCC
CAGCCCCCCTCACCCAGTGACAGCAACGTGCCCACTCCGGTGACGCCCGC
GCCCACAGCTCCTGTCATCAACGACGGTCCTCCGACCGCACCTTCGGCTG
CCACCAAATAAGTCCTCGAGTTGATTCTATCCAAAACCCCAGATTTTGTG
GCTGAATAAAGTGTTGGCGCACACACACACACACATTATGAAAAGGAAAT
AATTTTTAGTTTTTAACAGCACCATAATAAGTTTGATTACAAGAAAATCT
GATTGTAAGCTATCAACGATAAAAACGCATAGACATATATAACTGTTTTT
TGCCATAAAAAAAAAAAAAA

RH24988.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG7714-RA 1210 CG7714-RA 213..1170 2..959 4775 99.8 Plus
nc_17625.a 624 nc_17625.a 1..436 954..519 2165 99.7 Minus
nc_17625.a 624 nc_17625.a 405..624 526..307 1085 99.5 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14549498..14550360 955..93 4285 99.8 Minus
chr3R 27901430 chr3R 14550443..14550534 93..2 460 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18725394..18726260 959..93 4320 99.9 Minus
3R 32079331 3R 18726343..18726434 93..2 460 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18466225..18467091 959..93 4320 99.8 Minus
3R 31820162 3R 18467174..18467265 93..2 460 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:23:17 has no hits.

RH24988.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:24:05 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14549497..14550359 94..956 99 <- Minus
chr3R 14550443..14550534 1..93 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:43:48 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..678 84..761 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:09 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..678 84..761 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:44:39 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..678 84..761 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:53 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..678 84..761 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:30:55 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..678 84..761 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:23:04 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..954 2..956 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:08 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..954 2..956 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:44:39 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..954 2..956 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:53 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..954 2..956 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:30:55 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
CG7714-RA 1..953 2..954 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:24:05 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18726343..18726434 1..93 98   Minus
3R 18725397..18726259 94..956 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:24:05 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18726343..18726434 1..93 98   Minus
3R 18725397..18726259 94..956 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:24:05 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18726343..18726434 1..93 98   Minus
3R 18725397..18726259 94..956 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:44:39 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14551119..14551981 94..956 99 <- Minus
arm_3R 14552065..14552156 1..93 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:54 Download gff for RH24988.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18466228..18467090 94..956 99 <- Minus
3R 18467174..18467265 1..93 98   Minus

RH24988.pep Sequence

Translation from 83 to 760

> RH24988.pep
MKAVIFVLAVVVAMAGKAHAACSAVPQYTEKIDPVNCPQSGFKLPNYENA
SVYYQCTAQLQSDGSIVVTGVLTSCGEDTYFNYALQRCVACANYFPSAQC
SSLPINVTCVPISTVTTVAPTTGTTIAPTTASPTTAASTTAAPGESTTAA
PGESTTVTVPVPPTEAPGSTTASGSDDIITPTGTTISVPQPPSPSDSNVP
TPVTPAPTAPVINDGPPTAPSAATK*

RH24988.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17868-PA 219 GF17868-PA 1..214 1..224 343 44.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16348-PA 299 GG16348-PA 1..294 1..221 671 53.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22098-PA 196 GH22098-PA 1..196 1..217 204 38.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG7714-PA 225 CG7714-PA 1..225 1..225 1172 100 Plus
CG34220-PA 726 CG34220-PA 142..261 108..223 170 36.2 Plus
CG34220-PA 726 CG34220-PA 317..434 108..224 170 35.2 Plus
Muc55B-PB 485 CG5765-PB 127..338 47..222 168 34 Plus
Muc55B-PA 485 CG5765-PA 127..338 47..222 168 34 Plus
Muc26B-PA 471 CG13990-PA 130..280 56..208 161 32.7 Plus
CG34220-PA 726 CG34220-PA 133..241 108..218 160 35.1 Plus
CG34220-PA 726 CG34220-PA 430..532 111..224 160 35.9 Plus
Muc26B-PA 471 CG13990-PA 155..288 73..208 160 35.3 Plus
Muc26B-PA 471 CG13990-PA 163..296 73..208 160 35.3 Plus
Muc26B-PA 471 CG13990-PA 171..304 73..208 160 35.3 Plus
Muc26B-PA 471 CG13990-PA 179..312 73..208 160 35.3 Plus
Muc26B-PA 471 CG13990-PA 187..320 73..208 160 35.3 Plus
Muc26B-PA 471 CG13990-PA 195..355 73..224 160 32.3 Plus
CG34220-PA 726 CG34220-PA 275..413 96..223 158 31.7 Plus
Muc55B-PB 485 CG5765-PB 253..380 96..222 158 37.8 Plus
Muc55B-PB 485 CG5765-PB 258..394 96..222 158 37.3 Plus
Muc55B-PA 485 CG5765-PA 253..380 96..222 158 37.8 Plus
Muc55B-PA 485 CG5765-PA 258..394 96..222 158 37.3 Plus
Muc55B-PB 485 CG5765-PB 304..424 107..224 157 38.9 Plus
Muc55B-PA 485 CG5765-PA 304..424 107..224 157 38.9 Plus
Muc26B-PA 471 CG13990-PA 124..264 66..208 157 34.2 Plus
Muc4B-PC 496 CG32774-PC 217..341 104..224 157 34.6 Plus
Muc4B-PB 496 CG32774-PB 217..341 104..224 157 34.6 Plus
Mur89F-PC 2158 CG4090-PC 1335..1510 37..218 157 26.9 Plus
Mur89F-PB 2159 CG4090-PB 1335..1510 37..218 157 26.9 Plus
CG34220-PA 726 CG34220-PA 6..229 5..221 156 26.3 Plus
Muc26B-PA 471 CG13990-PA 87..240 46..208 156 33.5 Plus
Mur82C-PB 578 CG12586-PB 198..306 107..224 156 33.1 Plus
Muc55B-PB 485 CG5765-PB 290..408 107..222 155 39.5 Plus
Muc55B-PA 485 CG5765-PA 290..408 107..222 155 39.5 Plus
Muc26B-PA 471 CG13990-PA 219..370 73..225 154 32.9 Plus
CG46026-PA 666 CG46026-PA 554..666 108..224 154 32.8 Plus
CG46026-PA 666 CG46026-PA 482..598 104..224 152 30.6 Plus
Mur89F-PC 2158 CG4090-PC 1806..1973 36..224 151 31.1 Plus
Mur89F-PB 2159 CG4090-PB 1806..1973 36..224 151 31.1 Plus
CG46026-PA 666 CG46026-PA 282..395 108..225 151 29.7 Plus
Muc26B-PA 471 CG13990-PA 259..402 73..222 150 33.3 Plus
Sgs1-PA 1286 CG3047-PA 519..643 100..224 149 31.3 Plus
Muc55B-PB 485 CG5765-PB 318..438 107..221 148 38.9 Plus
Muc55B-PA 485 CG5765-PA 318..438 107..221 148 38.9 Plus
Muc96D-PA 881 CG31439-PA 354..470 108..224 148 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21958-PA 210 GI21958-PA 1..210 1..220 271 40.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23110-PA 449 GL23110-PA 233..446 4..222 445 57.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20537-PA 233 GA20537-PA 1..226 1..218 431 53.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18687-PA 86 GM18687-PA 1..79 1..81 267 64.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14317-PA 207 GJ14317-PA 1..175 1..189 182 36.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25177-PA 212 GE25177-PA 1..212 1..225 590 59.3 Plus

RH24988.hyp Sequence

Translation from 83 to 760

> RH24988.hyp
MKAVIFVLAVVVAMAGKAHAACSAVPQYTEKIDPVNCPQSGFKLPNYENA
SVYYQCTAQLQSDGSIVVTGVLTSCGEDTYFNYALQRCVACANYFPSAQC
SSLPINVTCVPISTVTTVAPTTGTTIAPTTASPTTAASTTAAPGESTTAA
PGESTTVTVPVPPTEAPGSTTASGSDDIITPTGTTISVPQPPSPSDSNVP
TPVTPAPTAPVINDGPPTAPSAATK*

RH24988.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7714-PA 225 CG7714-PA 1..225 1..225 1172 100 Plus
CG34220-PA 726 CG34220-PA 142..261 108..223 170 36.2 Plus
CG34220-PA 726 CG34220-PA 317..434 108..224 170 35.2 Plus
Muc55B-PB 485 CG5765-PB 127..338 47..222 168 34 Plus
Muc55B-PA 485 CG5765-PA 127..338 47..222 168 34 Plus
Muc26B-PA 471 CG13990-PA 130..280 56..208 161 32.7 Plus
CG34220-PA 726 CG34220-PA 133..241 108..218 160 35.1 Plus
CG34220-PA 726 CG34220-PA 430..532 111..224 160 35.9 Plus
CG34220-PA 726 CG34220-PA 275..413 96..223 158 31.7 Plus
Muc55B-PB 485 CG5765-PB 253..380 96..222 158 37.8 Plus
Muc55B-PB 485 CG5765-PB 258..394 96..222 158 37.3 Plus
Muc55B-PA 485 CG5765-PA 258..394 96..222 158 37.3 Plus
Muc55B-PA 485 CG5765-PA 253..380 96..222 158 37.8 Plus
Muc55B-PB 485 CG5765-PB 304..424 107..224 157 38.9 Plus
Muc55B-PA 485 CG5765-PA 304..424 107..224 157 38.9 Plus
CG34220-PA 726 CG34220-PA 6..229 5..221 156 26.3 Plus
Muc55B-PB 485 CG5765-PB 290..408 107..222 155 39.5 Plus
Muc55B-PA 485 CG5765-PA 290..408 107..222 155 39.5 Plus
Muc55B-PB 485 CG5765-PB 318..438 107..221 148 38.9 Plus
Muc55B-PA 485 CG5765-PA 318..438 107..221 148 38.9 Plus