Clone RH25931 Report

Search the DGRC for RH25931

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:259
Well:31
Vector:pFlc-1
Associated Gene/TranscriptIM4-RA
Protein status:RH25931.pep: gold
Preliminary Size:262
Sequenced Size:432

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15231 2002-01-01 Sim4 clustering to Release 2
CG15231 2003-01-01 Sim4 clustering to Release 3
IM4 2008-04-29 Release 5.5 accounting
IM4 2008-08-15 Release 5.9 accounting
IM4 2008-12-18 5.12 accounting

Clone Sequence Records

RH25931.complete Sequence

432 bp (432 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070691

> RH25931.complete
GTTCAGTAACTCAGCATCAGTACTACCAAGCCAACCAACAACCACCAAAC
CTCAGAAATCAACATGAAGTTCTTCCAAGCCGCCGCCCTTCTCTTGGCCA
TGTTCGCTGCCCTCGCCAACGCCGAGCCCGTTCCCCAACCTGGAACCGTG
CTCATCCAGACCGACAACACCCAGTACATTCGTACTGGTTAGGATTAGAG
AACCATGTTGACCCAACATTTGACATTTGCCTATCCATTTGGACTTTTGA
ATAAAAATTTTAAAATTACCTAAACTCATTTTTATTATTTAATATATGAT
TAATATTGTAATTTTAAAATGTATGAAATTCTAGTGAACAGAGTACAAAA
GTCAAAAGTACAAAAAGTCACTTCAAAGTCAGTGCAAATTTCGTCATTAA
AAAACATTTATAAAAATAAAAAAAAAAAAAAA

RH25931.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
IM4-RA 752 IM4-RA 186..601 3..418 2080 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16755373..16755646 417..140 1160 95.3 Minus
chr2R 21145070 chr2R 16755706..16755842 139..3 685 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20868844..20869122 418..140 1395 100 Minus
2R 25286936 2R 20869182..20869318 139..3 685 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20870043..20870321 418..140 1395 100 Minus
2R 25260384 2R 20870381..20870517 139..3 685 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:50:16 has no hits.

RH25931.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:51:08 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16755706..16755842 1..139 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:43:57 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..129 64..192 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:45 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..129 64..192 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:25 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..129 64..192 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:52 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..129 64..192 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:56:21 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..129 64..192 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:11 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..418 1..417 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:44 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..418 1..417 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:25 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..418 1..417 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:52 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..418 1..417 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:56:21 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 1..418 1..417 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:08 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20868845..20869122 140..417 100 <- Minus
2R 20869182..20869318 1..139 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:08 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20868845..20869122 140..417 100 <- Minus
2R 20869182..20869318 1..139 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:08 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20868845..20869122 140..417 100 <- Minus
2R 20869182..20869318 1..139 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:25 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16756350..16756627 140..417 100 <- Minus
arm_2R 16756687..16756823 1..139 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:58 Download gff for RH25931.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20870044..20870321 140..417 100 <- Minus
2R 20870381..20870517 1..139 98   Minus

RH25931.hyp Sequence

Translation from 2 to 253

> RH25931.hyp
SVTQHQYYQANQQPPNLRNQHEVLPSRRPSLGHVRCPRQRRARSPTWNRA
HPDRQHPVHSYWLGLENHVDPTFDICLSIWTFE*
Sequence RH25931.hyp has no blast hits.

RH25931.pep Sequence

Translation from 63 to 191

> RH25931.pep
MKFFQAAALLLAMFAALANAEPVPQPGTVLIQTDNTQYIRTG*

RH25931.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12738-PA 42 GF12738-PA 1..42 1..42 211 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20823-PA 42 GG20823-PA 1..42 1..42 211 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19877-PA 42 GH19877-PA 1..42 1..42 183 81 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
IM4-PB 42 CG15231-PB 1..42 1..42 209 100 Plus
IM4-PA 42 CG15231-PA 1..42 1..42 209 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19828-PA 42 GI19828-PA 1..42 1..42 140 78.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17418-PA 42 GL17418-PA 1..42 1..42 127 90.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24819-PA 42 GA24819-PA 1..42 1..42 127 90.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15770-PA 42 GM15770-PA 1..42 1..42 211 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25246-PA 42 GD25246-PA 1..42 1..42 211 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18607-PA 42 GJ18607-PA 1..42 1..42 127 90.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22878-PA 42 GK22878-PA 1..42 1..42 127 90.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13764-PA 42 GE13764-PA 1..42 1..42 205 97.6 Plus