BDGP Sequence Production Resources |
Search the DGRC for RH25931
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 259 |
Well: | 31 |
Vector: | pFlc-1 |
Associated Gene/Transcript | IM4-RA |
Protein status: | RH25931.pep: gold |
Preliminary Size: | 262 |
Sequenced Size: | 432 |
Gene | Date | Evidence |
---|---|---|
CG15231 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15231 | 2003-01-01 | Sim4 clustering to Release 3 |
IM4 | 2008-04-29 | Release 5.5 accounting |
IM4 | 2008-08-15 | Release 5.9 accounting |
IM4 | 2008-12-18 | 5.12 accounting |
432 bp (432 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070691
> RH25931.complete GTTCAGTAACTCAGCATCAGTACTACCAAGCCAACCAACAACCACCAAAC CTCAGAAATCAACATGAAGTTCTTCCAAGCCGCCGCCCTTCTCTTGGCCA TGTTCGCTGCCCTCGCCAACGCCGAGCCCGTTCCCCAACCTGGAACCGTG CTCATCCAGACCGACAACACCCAGTACATTCGTACTGGTTAGGATTAGAG AACCATGTTGACCCAACATTTGACATTTGCCTATCCATTTGGACTTTTGA ATAAAAATTTTAAAATTACCTAAACTCATTTTTATTATTTAATATATGAT TAATATTGTAATTTTAAAATGTATGAAATTCTAGTGAACAGAGTACAAAA GTCAAAAGTACAAAAAGTCACTTCAAAGTCAGTGCAAATTTCGTCATTAA AAAACATTTATAAAAATAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IM4-RA | 752 | IM4-RA | 186..601 | 3..418 | 2080 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 16755706..16755842 | 1..139 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..129 | 64..192 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..129 | 64..192 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..129 | 64..192 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..129 | 64..192 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..129 | 64..192 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..418 | 1..417 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..418 | 1..417 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..418 | 1..417 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..418 | 1..417 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM4-RA | 1..418 | 1..417 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20868845..20869122 | 140..417 | 100 | <- | Minus |
2R | 20869182..20869318 | 1..139 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20868845..20869122 | 140..417 | 100 | <- | Minus |
2R | 20869182..20869318 | 1..139 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20868845..20869122 | 140..417 | 100 | <- | Minus |
2R | 20869182..20869318 | 1..139 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 16756350..16756627 | 140..417 | 100 | <- | Minus |
arm_2R | 16756687..16756823 | 1..139 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20870044..20870321 | 140..417 | 100 | <- | Minus |
2R | 20870381..20870517 | 1..139 | 98 | Minus |
Translation from 2 to 253
> RH25931.hyp SVTQHQYYQANQQPPNLRNQHEVLPSRRPSLGHVRCPRQRRARSPTWNRA HPDRQHPVHSYWLGLENHVDPTFDICLSIWTFE*
Translation from 63 to 191
> RH25931.pep MKFFQAAALLLAMFAALANAEPVPQPGTVLIQTDNTQYIRTG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12738-PA | 42 | GF12738-PA | 1..42 | 1..42 | 211 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20823-PA | 42 | GG20823-PA | 1..42 | 1..42 | 211 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19877-PA | 42 | GH19877-PA | 1..42 | 1..42 | 183 | 81 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IM4-PB | 42 | CG15231-PB | 1..42 | 1..42 | 209 | 100 | Plus |
IM4-PA | 42 | CG15231-PA | 1..42 | 1..42 | 209 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19828-PA | 42 | GI19828-PA | 1..42 | 1..42 | 140 | 78.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17418-PA | 42 | GL17418-PA | 1..42 | 1..42 | 127 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24819-PA | 42 | GA24819-PA | 1..42 | 1..42 | 127 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15770-PA | 42 | GM15770-PA | 1..42 | 1..42 | 211 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25246-PA | 42 | GD25246-PA | 1..42 | 1..42 | 211 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18607-PA | 42 | GJ18607-PA | 1..42 | 1..42 | 127 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22878-PA | 42 | GK22878-PA | 1..42 | 1..42 | 127 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13764-PA | 42 | GE13764-PA | 1..42 | 1..42 | 205 | 97.6 | Plus |