Clone RH26422 Report

Search the DGRC for RH26422

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:264
Well:22
Vector:pFlc-1
Associated Gene/TranscriptCG34330-RA
Protein status:RH26422.pep: gold
Preliminary Size:611
Sequenced Size:635

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7418 2002-01-01 Sim4 clustering to Release 2
CG33254 2002-01-09 Blastp of sequenced clone
CG34330 2008-04-29 Release 5.5 accounting
CG34330 2008-08-15 Release 5.9 accounting
CG34330 2008-12-18 5.12 accounting

Clone Sequence Records

RH26422.complete Sequence

635 bp (635 high quality bases) assembled on 2009-01-15

GenBank Submission: AY089663.1

> RH26422.complete
GATATAGTGCAAAAAGCTCTACTCGCGTTCACTTCGCATCCGCTCGCCGC
ATTCCCGTCCGCACCCGGAGTAGTGTCCAGTCACTCGTCACTCGTCCCGA
TTTCCCGCAAGAGAGCAAGCAACAGCATGTGGTCGAAAATTGCCATCGCC
GGAGCCCTGCTCGTGATGGGTGGCGTCCTGTCCTCCAGCGTGGTGGACAA
CTTCGCCTACGTGGATCGCTCGCTGCCGGTGGCCATGCCCAAGGCAAAGG
CCTTCCAAGTGAAACAGGAGTGAGGATCCCAGGAGGAGGGGGTTTTCTCA
AGTGGATCCCGACTGGCTGTGTCGATTAGGCAGTTCCTGGAGCAGGAACC
CCGTGCTCTTCACTCGGCAGCTGGGATATCTACTGGCCAGCCGGCTACTC
TGGCTTGTGTTTGAGCTACAAGTTGACCACAAGTGGGAAATAGTTGGTGC
AGGTCATCAAGTCGATGCACCCGCTGGGAAGCCACCTCCTTGCCCATAGG
AACAATTCGAGCACTAAACTTTAATTTAGATATATTTTTTTTTTTTGTTA
ACTTAATGTGACTAATTTAAGGAGTTCCCTATGCGTAAGCAATAAATAAG
TTAAACTTGACTGTCAAACGAAAAAAAAAAAAAAA

RH26422.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34330-RA 620 CG34330-RA 3..620 4..622 3055 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18957219..18957830 620..4 2910 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19068273..19068890 622..4 3045 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19076371..19076988 622..4 3055 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 02:31:24 has no hits.

RH26422.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:32:29 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18957219..18957832 1..620 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:03 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 1..147 127..273 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:21 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 1..147 127..273 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:00:31 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 1..147 127..273 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:22 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 1..147 127..273 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:13:51 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 1..147 127..273 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-15 09:52:24 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 3..618 4..620 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:21 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 3..618 4..620 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:00:31 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 3..618 4..620 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:22 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 3..618 4..620 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:13:51 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 3..618 4..620 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:32:29 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
X 19068275..19068892 1..620 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:32:29 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
X 19068275..19068892 1..620 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:32:29 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
X 19068275..19068892 1..620 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:00:31 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18962308..18962925 1..620 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:06 Download gff for RH26422.complete
Subject Subject Range Query Range Percent Splice Strand
X 19076373..19076990 1..620 99   Minus

RH26422.pep Sequence

Translation from 0 to 272

> RH26422.pep
DIVQKALLAFTSHPLAAFPSAPGVVSSHSSLVPISRKRASNSMWSKIAIA
GALLVMGGVLSSSVVDNFAYVDRSLPVAMPKAKAFQVKQE*

RH26422.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34330-PB 48 CG34330-PB 1..48 43..90 235 100 Plus
CG34330-PA 48 CG34330-PA 1..48 43..90 235 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22774-PA 48 GM22774-PA 1..48 43..90 240 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15608-PA 48 GD15608-PA 1..48 43..90 240 97.9 Plus

RH26422.hyp Sequence

Translation from 2 to 328

> RH26422.hyp
HSAKSSTRVHFASARRIPVRTRSSVQSLVTRPDFPQESKQQHVVENCHRR
SPARDGWRPVLQRGGQLRLRGSLAAGGHAQGKGLPSETGVRIPGGGGFLK
WIPTGCVD*
Sequence RH26422.hyp has no blast hits.