Clone RH26504 Report

Search the DGRC for RH26504

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:265
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCG5104-RB
Protein status:RH26504.pep: gold
Preliminary Size:492
Sequenced Size:1137

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5104 2002-01-01 Sim4 clustering to Release 2
CG5104 2002-05-23 Blastp of sequenced clone
CG5104 2003-01-01 Sim4 clustering to Release 3
CG5104 2008-04-29 Release 5.5 accounting
CG5104 2008-08-15 Release 5.9 accounting
CG5104 2008-12-18 5.12 accounting

Clone Sequence Records

RH26504.complete Sequence

1137 bp (1137 high quality bases) assembled on 2002-05-23

GenBank Submission: AY118429

> RH26504.complete
GACACTAGGTATGATCTTGGATTTATTTTGGTGTGAAAATTCCGGAGCAT
AAAAACAGAAGAGACCCTTGTATGTGCAAAACCCCCCGAGAGGAGTGCCG
GTAATTCCAAGTCAGCCACCTGTTGAACATTATTCAATCGCCGCATAATG
GACAAGTTGCGCCGCGTTCTGAGTGGAGATGAGCCCACTCCGGAGGAGGA
GAGCAGTATCATTACGCAGATCAACGACATGTCCACTTTGAGCTGGTCCA
CTCGGATCAAGGGATTCGTCATCTGCTTTGCCTTGGGCATCTTACTTTCC
CTACTCGGCTCGGTCGCCCTATTTCTGCACAGGGGCATTGTGGTCTTTGC
GGTCTTCTACACTCTAGGAAACGTCATCTCGATGGCCAGTACCTGCTTTC
TCATGGGTCCCTTCAAGCAGATCAAGAAAATGTTTGCGGAAACACGGCTG
ATCGCCACCATCATCGTGCTCGTCATGATGGTCCTGACGTTCATCGCTGC
TATTGTGTGGAAAAAGGCGGGACTCACGCTTATATTCATTATCATACAAT
CTCTGGCCATGACCTGGTACTCGCTGTCGTACATCCCCTACGCCCGCGAT
GCGGTCAAGAAGACCATGTCGGCAATTCTGGAGGTCTAGAATCAGATGCG
CTTCTGTACATAGCTCGAGAAAAGCCAGATTGGTTTGTAGCTTAAGCTAA
GACAATTAAATCTTTTGTATTGTATTAACCTAGCACTAGAACATAGAATG
TCCTTTATATTCTCTTATTAACAAGTACAATAATTCCATTTTGTCTTTTT
AATAAATATATATATATATATATATATATCTTTTATACATATATATATAT
ATATTTACATGTTATGTATTTAATTTAATCAGTACAGTTTTCTTTAGTTT
ATGTACATAATTCTCTTCTCTGTTTTGGTTTTTAATTTAAAGAATGGCCC
GATCCACTTTGTTTCTGCAGCTTTAAAGTTTATTTATATCAACTTCTTAT
TTTAGTTTCTTCTCTTTTTGCGGCGACAATTTACCTAGAAAAGTGAAATG
AAAAATTGTAGATCAAAAGTAGCAGATATAAAAGTTAACAATAACTGGTT
AGACTATTTTAAAAAAAAAAAAAAAAAAAAAAAAAAA

RH26504.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5104-RB 1235 CG5104-RB 126..1235 2..1111 5550 100 Plus
CG4825-RA 2298 CG4825-RA 1938..2298 1036..676 1805 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20511144..20511747 507..1110 3020 100 Plus
chr3L 24539361 chr3L 20510000..20510217 2..219 1090 100 Plus
chr3L 24539361 chr3L 20510398..20510574 213..389 885 100 Plus
chr3L 24539361 chr3L 20510647..20510767 387..507 605 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20522154..20522759 507..1112 3030 100 Plus
3L 28110227 3L 20521010..20521227 2..219 1090 100 Plus
3L 28110227 3L 20521408..20521584 213..389 885 100 Plus
3L 28110227 3L 20521657..20521777 387..507 605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20515254..20515859 507..1112 3030 100 Plus
3L 28103327 3L 20514110..20514327 2..219 1090 100 Plus
3L 28103327 3L 20514508..20514684 213..389 885 100 Plus
3L 28103327 3L 20514757..20514877 387..507 605 100 Plus
Blast to na_te.dros performed 2019-03-16 15:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 6664..6834 937..762 163 59.3 Minus
Dbuz\Galileo 2304 Dbuz\Galileo GALILEO 2304bp 1028..1124 795..886 113 60.8 Plus

RH26504.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:32:13 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20510405..20510574 220..389 100 -> Plus
chr3L 20510650..20510767 390..507 100 -> Plus
chr3L 20509999..20510217 1..219 99 -> Plus
chr3L 20511145..20511438 508..801 100 == Plus
chr3L 20511492..20511747 855..1110 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:07 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 1..492 148..639 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:37:43 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 1..492 148..639 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:12:51 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 1..492 148..639 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:29:21 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 1..492 148..639 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:43:49 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 1..492 148..639 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:10:20 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 2..1110 2..1110 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:37:43 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 2..1110 2..1110 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:12:51 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 2..788 2..788 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:29:21 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 2..1110 2..1110 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:43:49 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
CG5104-RB 2..787 2..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:13 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20521009..20521227 1..219 99 -> Plus
3L 20521415..20521584 220..389 100 -> Plus
3L 20521660..20521777 390..507 100 -> Plus
3L 20522155..20522757 508..1110 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:13 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20521009..20521227 1..219 99 -> Plus
3L 20521415..20521584 220..389 100 -> Plus
3L 20521660..20521777 390..507 100 -> Plus
3L 20522155..20522757 508..1110 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:13 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20521009..20521227 1..219 99 -> Plus
3L 20521415..20521584 220..389 100 -> Plus
3L 20521660..20521777 390..507 100 -> Plus
3L 20522155..20522757 508..1110 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:12:51 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20514515..20514684 220..389 100 -> Plus
arm_3L 20514760..20514877 390..507 100 -> Plus
arm_3L 20514109..20514327 1..219 99 -> Plus
arm_3L 20515255..20515857 508..1110 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:01:58 Download gff for RH26504.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20514515..20514684 220..389 100 -> Plus
3L 20514760..20514877 390..507 100 -> Plus
3L 20514109..20514327 1..219 99 -> Plus
3L 20515255..20515857 508..1110 100   Plus

RH26504.pep Sequence

Translation from 147 to 638

> RH26504.pep
MDKLRRVLSGDEPTPEEESSIITQINDMSTLSWSTRIKGFVICFALGILL
SLLGSVALFLHRGIVVFAVFYTLGNVISMASTCFLMGPFKQIKKMFAETR
LIATIIVLVMMVLTFIAAIVWKKAGLTLIFIIIQSLAMTWYSLSYIPYAR
DAVKKTMSAILEV*

RH26504.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10353-PA 163 GF10353-PA 1..163 1..163 764 89.6 Plus
Dana\GF19041-PA 163 GF19041-PA 1..163 1..163 756 89 Plus
Dana\GF20483-PA 163 GF20483-PA 1..163 1..163 756 89 Plus
Dana\GF24537-PA 203 GF24537-PA 43..184 15..154 138 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16126-PA 163 GG16126-PA 1..163 1..163 828 97.5 Plus
Dere\GG24673-PA 199 GG24673-PA 40..180 15..154 150 31.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14556-PA 163 GH14556-PA 1..163 1..163 730 84.7 Plus
Dgri\GH10230-PA 204 GH10230-PA 34..185 4..154 153 30.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG5104-PB 163 CG5104-PB 1..163 1..163 804 100 Plus
CG33635-PA 199 CG33635-PA 40..180 15..154 170 31.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13404-PA 163 GI13404-PA 1..163 1..163 736 85.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12798-PA 163 GL12798-PA 1..163 1..163 760 89 Plus
Dper\GL19288-PA 205 GL19288-PA 41..186 12..154 149 30.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18661-PA 163 GA18661-PA 1..163 1..163 760 89 Plus
Dpse\GA25900-PA 205 GA25900-PA 41..186 12..154 149 30.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22305-PA 163 GM22305-PA 1..163 1..163 827 97.5 Plus
Dsec\GM16692-PA 199 GM16692-PA 40..180 15..154 151 31.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14898-PA 163 GD14898-PA 1..163 1..163 832 98.2 Plus
Dsim\GD22980-PA 199 GD22980-PA 40..180 15..154 151 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11529-PA 163 GJ11529-PA 1..163 1..163 718 82.8 Plus
Dvir\GJ17253-PA 204 GJ17253-PA 42..185 11..154 137 29.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12044-PA 163 GK12044-PA 1..163 1..163 706 89 Plus
Dwil\GK23762-PA 206 GK23762-PA 44..185 15..154 136 30.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19694-PA 163 GE19694-PA 1..163 1..163 832 98.8 Plus
Dyak\GE23240-PA 163 GE23240-PA 1..163 1..163 832 98.8 Plus
Dyak\GE16372-PA 199 GE16372-PA 40..180 15..154 145 30.5 Plus

RH26504.hyp Sequence

Translation from 147 to 638

> RH26504.hyp
MDKLRRVLSGDEPTPEEESSIITQINDMSTLSWSTRIKGFVICFALGILL
SLLGSVALFLHRGIVVFAVFYTLGNVISMASTCFLMGPFKQIKKMFAETR
LIATIIVLVMMVLTFIAAIVWKKAGLTLIFIIIQSLAMTWYSLSYIPYAR
DAVKKTMSAILEV*

RH26504.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG5104-PB 163 CG5104-PB 1..163 1..163 804 100 Plus
CG33635-PA 199 CG33635-PA 40..180 15..154 170 31.2 Plus