Clone RH26557 Report

Search the DGRC for RH26557

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:265
Well:57
Vector:pFlc-1
Associated Gene/TranscriptCG11211-RA
Protein status:RH26557.pep: gold
Preliminary Size:531
Sequenced Size:609

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11211 2002-01-01 Sim4 clustering to Release 2
CG11211 2002-04-21 Blastp of sequenced clone
CG11211 2003-01-01 Sim4 clustering to Release 3
CG11211 2008-04-29 Release 5.5 accounting
CG11211 2008-08-15 Release 5.9 accounting
CG11211 2008-12-18 5.12 accounting

Clone Sequence Records

RH26557.complete Sequence

609 bp (609 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113575

> RH26557.complete
GATTCAGCATGGTTACCATACTGTTCACTATCTTTAGCTTACCTTTCTTG
GTAATAGCATCCAGCAACATCAACAATACCGATTTGACTTTTTATCAAAA
GTGCAATCCGCTTCTTCAGTGCAATGCATATTTTTCAGTGGCAGGTTTTG
CTGAAGTAAACTGGCTTGAAGCTAACCATGTATGCAATAGAGTTGGAGCA
GTCCTAGCTACTGTCAGAAATGAGGAGCAGCATCAGCTAATGCTTCACTA
CGTCAACAGGAAAGAACGGATATTTGGAAACAGAACCTTTTGGTTGGGCG
CCACAAACCTGGTGGATCGGAGCTATTTCTGGACCTGGATGAGCACTGGC
ATTCCCGTTACCTACGCACAATGGAGCCGGAGAGAGCCCAAGTCTGATCG
AACAGGTCAAGACGCCTGCCTGGTCTTGGGAACAGACAATCTCTGGCATA
GTGAACCTTGCCAACGGAAACACAATTTTATTTGCGAAAATGTTTGTCAG
CTAAATTATTCAGGGCTGGACAAGAGAGTATATATATAAAATTGTTATTT
CAATCTGAAAATATATAAAACAATATCCAAAGCAAAATGAATAGAAAAAA
AAAAAAAAA

RH26557.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11211-RA 614 CG11211-RA 15..609 2..596 2960 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2067991..2068322 594..263 1600 98.8 Minus
chr2R 21145070 chr2R 2068534..2068691 159..2 775 99.4 Minus
chr2R 21145070 chr2R 2068372..2068480 264..156 545 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6180924..6181257 596..263 1655 99.7 Minus
2R 25286936 2R 6181469..6181626 159..2 790 100 Minus
2R 25286936 2R 6181307..6181415 264..156 545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6182123..6182456 596..263 1655 99.7 Minus
2R 25260384 2R 6182668..6182825 159..2 790 100 Minus
2R 25260384 2R 6182506..6182614 264..156 545 100 Minus
Blast to na_te.dros performed 2019-03-16 20:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 12..61 579..528 110 73.1 Minus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 13..62 579..528 110 73.1 Minus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 6415..6464 579..528 110 73.1 Minus

RH26557.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:51:10 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2067991..2068320 265..594 98 <- Minus
chr2R 2068372..2068480 156..264 100 <- Minus
chr2R 2068538..2068691 1..155 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:10 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..531 9..539 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:42:47 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..531 9..539 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:33 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..531 9..539 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:21:46 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..531 9..539 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:56:27 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..531 9..539 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:02 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..593 2..594 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:42:47 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..593 2..594 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:33 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..593 2..594 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:21:46 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..593 2..594 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:56:27 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
CG11211-RA 1..593 2..594 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:10 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6180926..6181255 265..594 99 <- Minus
2R 6181307..6181415 156..264 100 <- Minus
2R 6181473..6181626 1..155 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:10 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6180926..6181255 265..594 99 <- Minus
2R 6181307..6181415 156..264 100 <- Minus
2R 6181473..6181626 1..155 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:10 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6180926..6181255 265..594 99 <- Minus
2R 6181307..6181415 156..264 100 <- Minus
2R 6181473..6181626 1..155 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:33 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2068978..2069131 1..155 99   Minus
arm_2R 2068431..2068760 265..594 99 <- Minus
arm_2R 2068812..2068920 156..264 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:23 Download gff for RH26557.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6182125..6182454 265..594 99 <- Minus
2R 6182506..6182614 156..264 100 <- Minus
2R 6182672..6182825 1..155 99   Minus

RH26557.hyp Sequence

Translation from 2 to 538

> RH26557.hyp
FSMVTILFTIFSLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFA
EVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGA
TNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHS
EPCQRKHNFICENVCQLNYSGLDKRVYI*

RH26557.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11211-PA 176 CG11211-PA 1..176 3..178 964 100 Plus
CG9134-PC 188 CG9134-PC 67..184 49..162 167 28.9 Plus
CG9134-PA 188 CG9134-PA 67..184 49..162 167 28.9 Plus
CG9134-PB 376 CG9134-PB 255..372 49..162 167 28.9 Plus
lectin-21Cb-PB 249 CG13686-PB 116..249 22..164 158 31 Plus

RH26557.pep Sequence

Translation from 8 to 538

> RH26557.pep
MVTILFTIFSLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFAEV
NWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATN
LVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEP
CQRKHNFICENVCQLNYSGLDKRVYI*

RH26557.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13816-PA 162 GF13816-PA 27..162 41..176 484 61 Plus
Dana\GF24446-PA 386 GF24446-PA 251..382 34..160 159 29.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10829-PA 176 GG10829-PA 1..176 1..176 863 90.3 Plus
Dere\GG14773-PA 376 GG14773-PA 241..372 34..160 159 29.6 Plus
Dere\GG23197-PA 182 GG23197-PA 43..178 33..166 153 24.6 Plus
Dere\GG24634-PA 172 GG24634-PA 39..170 20..160 140 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20945-PA 110 GH20945-PA 2..104 65..168 228 40.4 Plus
Dgri\GH15445-PA 407 GH15445-PA 272..403 34..160 155 28.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG11211-PA 176 CG11211-PA 1..176 1..176 964 100 Plus
tfc-PC 188 CG9134-PC 67..184 47..160 167 28.9 Plus
tfc-PA 188 CG9134-PA 67..184 47..160 167 28.9 Plus
tfc-PB 376 CG9134-PB 255..372 47..160 167 28.9 Plus
lectin-21Cb-PB 249 CG13686-PB 116..249 20..162 158 31 Plus
CG8343-PA 182 CG8343-PA 52..178 42..166 152 25 Plus
CG12111-PB 188 CG12111-PB 55..174 41..160 140 25.4 Plus
CG12111-PA 188 CG12111-PA 55..174 41..160 140 25.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21283-PA 108 GI21283-PA 2..99 65..163 244 43.4 Plus
Dmoj\GI13046-PA 379 GI13046-PA 244..375 34..160 154 28.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16256-PA 172 GL16256-PA 1..172 4..176 513 50.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10845-PA 172 GA10845-PA 1..172 4..176 514 50.9 Plus
Dpse\GA21567-PA 381 GA21567-PA 246..377 34..160 156 29.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16478-PA 163 GM16478-PA 1..163 1..163 851 96.3 Plus
Dsec\GM14393-PA 375 GM14393-PA 240..371 34..160 159 29.6 Plus
Dsec\GM16537-PA 182 GM16537-PA 43..178 33..166 146 24.6 Plus
Dsec\GM16651-PA 249 GM16651-PA 116..247 20..160 141 28.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10332-PA 176 GD10332-PA 1..176 1..176 902 94.3 Plus
Dsim\GD13601-PA 375 GD13601-PA 240..371 34..160 159 29.6 Plus
Dsim\GD10399-PA 182 GD10399-PA 43..178 33..166 148 24.8 Plus
Dsim\GD22945-PA 257 GD22945-PA 124..255 20..160 140 28.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20885-PA 154 GJ20885-PA 23..143 42..163 294 41.8 Plus
Dvir\GJ12142-PA 412 GJ12142-PA 277..408 34..160 155 28.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21990-PA 101 GK21990-PA 19..88 22..90 167 48.6 Plus
Dwil\GK21163-PA 190 GK21163-PA 55..186 34..160 160 28.9 Plus
Dwil\GK21333-PA 178 GK21333-PA 40..170 33..163 147 28.9 Plus
Dwil\GK25689-PA 196 GK25689-PA 63..182 41..160 139 26.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19424-PA 176 GE19424-PA 1..176 1..176 850 86.9 Plus
Dyak\GE21136-PA 379 GE21136-PA 244..375 34..160 159 29.6 Plus
Dyak\GE20736-PA 182 GE20736-PA 43..178 33..166 148 23.4 Plus
Dyak\GE17444-PA 188 GE17444-PA 55..174 41..160 138 25.4 Plus