BDGP Sequence Production Resources |
Search the DGRC for RH26557
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 265 |
Well: | 57 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG11211-RA |
Protein status: | RH26557.pep: gold |
Preliminary Size: | 531 |
Sequenced Size: | 609 |
Gene | Date | Evidence |
---|---|---|
CG11211 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11211 | 2002-04-21 | Blastp of sequenced clone |
CG11211 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11211 | 2008-04-29 | Release 5.5 accounting |
CG11211 | 2008-08-15 | Release 5.9 accounting |
CG11211 | 2008-12-18 | 5.12 accounting |
609 bp (609 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113575
> RH26557.complete GATTCAGCATGGTTACCATACTGTTCACTATCTTTAGCTTACCTTTCTTG GTAATAGCATCCAGCAACATCAACAATACCGATTTGACTTTTTATCAAAA GTGCAATCCGCTTCTTCAGTGCAATGCATATTTTTCAGTGGCAGGTTTTG CTGAAGTAAACTGGCTTGAAGCTAACCATGTATGCAATAGAGTTGGAGCA GTCCTAGCTACTGTCAGAAATGAGGAGCAGCATCAGCTAATGCTTCACTA CGTCAACAGGAAAGAACGGATATTTGGAAACAGAACCTTTTGGTTGGGCG CCACAAACCTGGTGGATCGGAGCTATTTCTGGACCTGGATGAGCACTGGC ATTCCCGTTACCTACGCACAATGGAGCCGGAGAGAGCCCAAGTCTGATCG AACAGGTCAAGACGCCTGCCTGGTCTTGGGAACAGACAATCTCTGGCATA GTGAACCTTGCCAACGGAAACACAATTTTATTTGCGAAAATGTTTGTCAG CTAAATTATTCAGGGCTGGACAAGAGAGTATATATATAAAATTGTTATTT CAATCTGAAAATATATAAAACAATATCCAAAGCAAAATGAATAGAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11211-RA | 614 | CG11211-RA | 15..609 | 2..596 | 2960 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 2067991..2068322 | 594..263 | 1600 | 98.8 | Minus |
chr2R | 21145070 | chr2R | 2068534..2068691 | 159..2 | 775 | 99.4 | Minus |
chr2R | 21145070 | chr2R | 2068372..2068480 | 264..156 | 545 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Uvir | 6564 | Dvir\Uvir VIRUVIR 6564bp | 12..61 | 579..528 | 110 | 73.1 | Minus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 13..62 | 579..528 | 110 | 73.1 | Minus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 6415..6464 | 579..528 | 110 | 73.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 2067991..2068320 | 265..594 | 98 | <- | Minus |
chr2R | 2068372..2068480 | 156..264 | 100 | <- | Minus |
chr2R | 2068538..2068691 | 1..155 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..531 | 9..539 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..531 | 9..539 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..531 | 9..539 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..531 | 9..539 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..531 | 9..539 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..593 | 2..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..593 | 2..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..593 | 2..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..593 | 2..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11211-RA | 1..593 | 2..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6180926..6181255 | 265..594 | 99 | <- | Minus |
2R | 6181307..6181415 | 156..264 | 100 | <- | Minus |
2R | 6181473..6181626 | 1..155 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6180926..6181255 | 265..594 | 99 | <- | Minus |
2R | 6181307..6181415 | 156..264 | 100 | <- | Minus |
2R | 6181473..6181626 | 1..155 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6180926..6181255 | 265..594 | 99 | <- | Minus |
2R | 6181307..6181415 | 156..264 | 100 | <- | Minus |
2R | 6181473..6181626 | 1..155 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 2068978..2069131 | 1..155 | 99 | Minus | |
arm_2R | 2068431..2068760 | 265..594 | 99 | <- | Minus |
arm_2R | 2068812..2068920 | 156..264 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6182125..6182454 | 265..594 | 99 | <- | Minus |
2R | 6182506..6182614 | 156..264 | 100 | <- | Minus |
2R | 6182672..6182825 | 1..155 | 99 | Minus |
Translation from 2 to 538
> RH26557.hyp FSMVTILFTIFSLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFA EVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGA TNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHS EPCQRKHNFICENVCQLNYSGLDKRVYI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11211-PA | 176 | CG11211-PA | 1..176 | 3..178 | 964 | 100 | Plus |
CG9134-PC | 188 | CG9134-PC | 67..184 | 49..162 | 167 | 28.9 | Plus |
CG9134-PA | 188 | CG9134-PA | 67..184 | 49..162 | 167 | 28.9 | Plus |
CG9134-PB | 376 | CG9134-PB | 255..372 | 49..162 | 167 | 28.9 | Plus |
lectin-21Cb-PB | 249 | CG13686-PB | 116..249 | 22..164 | 158 | 31 | Plus |
Translation from 8 to 538
> RH26557.pep MVTILFTIFSLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFAEV NWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATN LVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEP CQRKHNFICENVCQLNYSGLDKRVYI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13816-PA | 162 | GF13816-PA | 27..162 | 41..176 | 484 | 61 | Plus |
Dana\GF24446-PA | 386 | GF24446-PA | 251..382 | 34..160 | 159 | 29.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10829-PA | 176 | GG10829-PA | 1..176 | 1..176 | 863 | 90.3 | Plus |
Dere\GG14773-PA | 376 | GG14773-PA | 241..372 | 34..160 | 159 | 29.6 | Plus |
Dere\GG23197-PA | 182 | GG23197-PA | 43..178 | 33..166 | 153 | 24.6 | Plus |
Dere\GG24634-PA | 172 | GG24634-PA | 39..170 | 20..160 | 140 | 30.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20945-PA | 110 | GH20945-PA | 2..104 | 65..168 | 228 | 40.4 | Plus |
Dgri\GH15445-PA | 407 | GH15445-PA | 272..403 | 34..160 | 155 | 28.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11211-PA | 176 | CG11211-PA | 1..176 | 1..176 | 964 | 100 | Plus |
tfc-PC | 188 | CG9134-PC | 67..184 | 47..160 | 167 | 28.9 | Plus |
tfc-PA | 188 | CG9134-PA | 67..184 | 47..160 | 167 | 28.9 | Plus |
tfc-PB | 376 | CG9134-PB | 255..372 | 47..160 | 167 | 28.9 | Plus |
lectin-21Cb-PB | 249 | CG13686-PB | 116..249 | 20..162 | 158 | 31 | Plus |
CG8343-PA | 182 | CG8343-PA | 52..178 | 42..166 | 152 | 25 | Plus |
CG12111-PB | 188 | CG12111-PB | 55..174 | 41..160 | 140 | 25.4 | Plus |
CG12111-PA | 188 | CG12111-PA | 55..174 | 41..160 | 140 | 25.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21283-PA | 108 | GI21283-PA | 2..99 | 65..163 | 244 | 43.4 | Plus |
Dmoj\GI13046-PA | 379 | GI13046-PA | 244..375 | 34..160 | 154 | 28.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16256-PA | 172 | GL16256-PA | 1..172 | 4..176 | 513 | 50.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10845-PA | 172 | GA10845-PA | 1..172 | 4..176 | 514 | 50.9 | Plus |
Dpse\GA21567-PA | 381 | GA21567-PA | 246..377 | 34..160 | 156 | 29.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16478-PA | 163 | GM16478-PA | 1..163 | 1..163 | 851 | 96.3 | Plus |
Dsec\GM14393-PA | 375 | GM14393-PA | 240..371 | 34..160 | 159 | 29.6 | Plus |
Dsec\GM16537-PA | 182 | GM16537-PA | 43..178 | 33..166 | 146 | 24.6 | Plus |
Dsec\GM16651-PA | 249 | GM16651-PA | 116..247 | 20..160 | 141 | 28.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10332-PA | 176 | GD10332-PA | 1..176 | 1..176 | 902 | 94.3 | Plus |
Dsim\GD13601-PA | 375 | GD13601-PA | 240..371 | 34..160 | 159 | 29.6 | Plus |
Dsim\GD10399-PA | 182 | GD10399-PA | 43..178 | 33..166 | 148 | 24.8 | Plus |
Dsim\GD22945-PA | 257 | GD22945-PA | 124..255 | 20..160 | 140 | 28.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20885-PA | 154 | GJ20885-PA | 23..143 | 42..163 | 294 | 41.8 | Plus |
Dvir\GJ12142-PA | 412 | GJ12142-PA | 277..408 | 34..160 | 155 | 28.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21990-PA | 101 | GK21990-PA | 19..88 | 22..90 | 167 | 48.6 | Plus |
Dwil\GK21163-PA | 190 | GK21163-PA | 55..186 | 34..160 | 160 | 28.9 | Plus |
Dwil\GK21333-PA | 178 | GK21333-PA | 40..170 | 33..163 | 147 | 28.9 | Plus |
Dwil\GK25689-PA | 196 | GK25689-PA | 63..182 | 41..160 | 139 | 26.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19424-PA | 176 | GE19424-PA | 1..176 | 1..176 | 850 | 86.9 | Plus |
Dyak\GE21136-PA | 379 | GE21136-PA | 244..375 | 34..160 | 159 | 29.6 | Plus |
Dyak\GE20736-PA | 182 | GE20736-PA | 43..178 | 33..166 | 148 | 23.4 | Plus |
Dyak\GE17444-PA | 188 | GE17444-PA | 55..174 | 41..160 | 138 | 25.4 | Plus |