Clone RH27094 Report

Search the DGRC for RH27094

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:270
Well:94
Vector:pFlc-1
Associated Gene/TranscriptRpL39-RA
Protein status:RH27094.pep: gold
Preliminary Size:272
Sequenced Size:310

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3997 2001-12-17 Blastp of sequenced clone
CG3997 2002-01-01 Sim4 clustering to Release 2
CG3997 2003-01-01 Sim4 clustering to Release 3
RpL39 2008-04-29 Release 5.5 accounting
RpL39 2008-08-15 Release 5.9 accounting
RpL39 2008-12-18 5.12 accounting

Clone Sequence Records

RH27094.complete Sequence

310 bp (310 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071712

> RH27094.complete
GCTTTTCTTTCCGGTGTGGCTCGTTGAAAAGATTGGACGAAATGGCTGCA
CACAAGTCGTTCAGAATAAAGCAGAAGCTGGCTAAGAAGCTGAAGCAGAA
CAGATCCGTTCCCCAATGGGTTCGCCTACGTACTGGCAACACTATTCGTT
ACAACGCTAAGCGCCGTCACTGGAGGCGTACCAAGTTGAAGCTGTAAGCT
GTTGATTCCAGGAGTTCCGCAATTTTGTGGAATGCTGAAGATCTTTTCGA
GAATATGAAATAATAAATTCGTCTACAATTTGCGGATTAAAAAAAAAAAA
AAAAAAAAAA

RH27094.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpL39-RA 571 RpL39-RA 96..383 4..291 1440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19947876..19948016 288..148 690 99.3 Minus
chr2R 21145070 chr2R 19948221..19948325 148..44 525 100 Minus
chr2R 21145070 chr2R 19948410..19948451 45..4 210 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24061850..24061993 291..148 720 100 Minus
2R 25286936 2R 24062198..24062302 148..44 525 100 Minus
2R 25286936 2R 24062387..24062428 45..4 210 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24063049..24063192 291..148 720 100 Minus
2R 25260384 2R 24063397..24063501 148..44 525 100 Minus
2R 25260384 2R 24063586..24063627 45..4 210 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:54:17 has no hits.

RH27094.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:55:31 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19947876..19948015 149..288 99 <- Minus
chr2R 19948221..19948324 45..148 100 <- Minus
chr2R 19948411..19948452 1..44 95   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:11 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 1..156 42..197 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:13 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 1..156 42..197 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:02 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 1..156 42..197 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:46 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 1..156 42..197 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:38:07 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 1..156 42..197 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:29 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 2..286 4..288 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:13 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 2..286 4..288 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:02 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 2..288 3..288 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:47 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 2..286 4..288 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:38:07 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 2..288 3..288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:31 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24062198..24062301 45..148 100 <- Minus
2R 24062388..24062429 1..44 95   Minus
2R 24061853..24061992 149..288 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:31 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24062198..24062301 45..148 100 <- Minus
2R 24062388..24062429 1..44 95   Minus
2R 24061853..24061992 149..288 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:31 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24062198..24062301 45..148 100 <- Minus
2R 24062388..24062429 1..44 95   Minus
2R 24061853..24061992 149..288 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:02 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19949376..19949515 149..288 100 <- Minus
arm_2R 19949721..19949824 45..148 100 <- Minus
arm_2R 19949911..19949952 1..44 95   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:39 Download gff for RH27094.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24063070..24063209 149..288 100 <- Minus
2R 24063415..24063518 45..148 100 <- Minus
2R 24063605..24063646 1..44 95   Minus

RH27094.hyp Sequence

Translation from 0 to 196

> RH27094.hyp
LSFRCGSLKRLDEMAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRY
NAKRRHWRRTKLKL*

RH27094.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
RpL39-PA 51 CG3997-PA 1..51 14..64 267 100 Plus

RH27094.pep Sequence

Translation from 41 to 196

> RH27094.pep
MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLK
L*

RH27094.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13482-PA 92 GF13482-PA 3..53 1..51 257 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19956-PA 51 GG19956-PA 1..51 1..51 252 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21710-PA 75 GH21710-PA 25..75 1..51 255 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
RpL39-PA 51 CG3997-PA 1..51 1..51 267 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20697-PA 50 GI20697-PA 1..50 2..51 245 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10425-PA 66 GL10425-PA 17..66 2..51 246 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17833-PA 66 GA17833-PA 17..66 2..51 247 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18276-PA 51 GM18276-PA 1..51 1..51 252 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24974-PA 51 GD24974-PA 1..51 1..51 252 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21891-PA 50 GJ21891-PA 1..50 2..51 245 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21387-PA 72 GK21387-PA 23..72 2..51 246 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11488-PA 51 GE11488-PA 1..51 1..51 252 100 Plus