![]() | BDGP Sequence Production Resources |
Search the DGRC for RH27094
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 270 |
Well: | 94 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL39-RA |
Protein status: | RH27094.pep: gold |
Preliminary Size: | 272 |
Sequenced Size: | 310 |
Gene | Date | Evidence |
---|---|---|
CG3997 | 2001-12-17 | Blastp of sequenced clone |
CG3997 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3997 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL39 | 2008-04-29 | Release 5.5 accounting |
RpL39 | 2008-08-15 | Release 5.9 accounting |
RpL39 | 2008-12-18 | 5.12 accounting |
310 bp (310 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071712
> RH27094.complete GCTTTTCTTTCCGGTGTGGCTCGTTGAAAAGATTGGACGAAATGGCTGCA CACAAGTCGTTCAGAATAAAGCAGAAGCTGGCTAAGAAGCTGAAGCAGAA CAGATCCGTTCCCCAATGGGTTCGCCTACGTACTGGCAACACTATTCGTT ACAACGCTAAGCGCCGTCACTGGAGGCGTACCAAGTTGAAGCTGTAAGCT GTTGATTCCAGGAGTTCCGCAATTTTGTGGAATGCTGAAGATCTTTTCGA GAATATGAAATAATAAATTCGTCTACAATTTGCGGATTAAAAAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL39-RA | 571 | RpL39-RA | 96..383 | 4..291 | 1440 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 19947876..19948016 | 288..148 | 690 | 99.3 | Minus |
chr2R | 21145070 | chr2R | 19948221..19948325 | 148..44 | 525 | 100 | Minus |
chr2R | 21145070 | chr2R | 19948410..19948451 | 45..4 | 210 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 24061850..24061993 | 291..148 | 720 | 100 | Minus |
2R | 25286936 | 2R | 24062198..24062302 | 148..44 | 525 | 100 | Minus |
2R | 25286936 | 2R | 24062387..24062428 | 45..4 | 210 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 24063049..24063192 | 291..148 | 720 | 100 | Minus |
2R | 25260384 | 2R | 24063397..24063501 | 148..44 | 525 | 100 | Minus |
2R | 25260384 | 2R | 24063586..24063627 | 45..4 | 210 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19947876..19948015 | 149..288 | 99 | <- | Minus |
chr2R | 19948221..19948324 | 45..148 | 100 | <- | Minus |
chr2R | 19948411..19948452 | 1..44 | 95 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 1..156 | 42..197 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 1..156 | 42..197 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 1..156 | 42..197 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 1..156 | 42..197 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 1..156 | 42..197 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 2..286 | 4..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 2..286 | 4..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 2..288 | 3..288 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 2..286 | 4..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL39-RA | 2..288 | 3..288 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24062198..24062301 | 45..148 | 100 | <- | Minus |
2R | 24062388..24062429 | 1..44 | 95 | Minus | |
2R | 24061853..24061992 | 149..288 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24062198..24062301 | 45..148 | 100 | <- | Minus |
2R | 24062388..24062429 | 1..44 | 95 | Minus | |
2R | 24061853..24061992 | 149..288 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24062198..24062301 | 45..148 | 100 | <- | Minus |
2R | 24062388..24062429 | 1..44 | 95 | Minus | |
2R | 24061853..24061992 | 149..288 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19949376..19949515 | 149..288 | 100 | <- | Minus |
arm_2R | 19949721..19949824 | 45..148 | 100 | <- | Minus |
arm_2R | 19949911..19949952 | 1..44 | 95 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24063070..24063209 | 149..288 | 100 | <- | Minus |
2R | 24063415..24063518 | 45..148 | 100 | <- | Minus |
2R | 24063605..24063646 | 1..44 | 95 | Minus |
Translation from 0 to 196
> RH27094.hyp LSFRCGSLKRLDEMAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRY NAKRRHWRRTKLKL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL39-PA | 51 | CG3997-PA | 1..51 | 14..64 | 267 | 100 | Plus |
Translation from 41 to 196
> RH27094.pep MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLK L*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13482-PA | 92 | GF13482-PA | 3..53 | 1..51 | 257 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19956-PA | 51 | GG19956-PA | 1..51 | 1..51 | 252 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21710-PA | 75 | GH21710-PA | 25..75 | 1..51 | 255 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL39-PA | 51 | CG3997-PA | 1..51 | 1..51 | 267 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20697-PA | 50 | GI20697-PA | 1..50 | 2..51 | 245 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10425-PA | 66 | GL10425-PA | 17..66 | 2..51 | 246 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17833-PA | 66 | GA17833-PA | 17..66 | 2..51 | 247 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18276-PA | 51 | GM18276-PA | 1..51 | 1..51 | 252 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24974-PA | 51 | GD24974-PA | 1..51 | 1..51 | 252 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21891-PA | 50 | GJ21891-PA | 1..50 | 2..51 | 245 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21387-PA | 72 | GK21387-PA | 23..72 | 2..51 | 246 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11488-PA | 51 | GE11488-PA | 1..51 | 1..51 | 252 | 100 | Plus |