Clone RH28021 Report

Search the DGRC for RH28021

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:280
Well:21
Vector:pFlc-1
Associated Gene/TranscriptTotA-RA
Protein status:RH28021.pep: gold
Sequenced Size:598

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31509 2003-02-13 Blastp of sequenced clone
TotA 2008-04-29 Release 5.5 accounting
TotA 2008-08-15 Release 5.9 accounting
TotA 2008-12-18 5.12 accounting

Clone Sequence Records

RH28021.complete Sequence

598 bp (598 high quality bases) assembled on 2003-02-13

GenBank Submission: BT011049

> RH28021.complete
GATTCCGGTTTGCTTCAGCGTTCCAAAAAGTCATAACCAAAATGAATTCT
TCAACTGCTCTTATGTGCTTTGCACTGCTGCTGATTAGTCCTCTATGCAT
GGGCTATTCCGACGAAGATCGTGAGGCTGACAACCTTAGAATTGCTGAAA
TTATCAAAAACGCCCAGGACGATGACTCCAAAATCAATAGCACCCAGGAA
CTACTTGACATCTATAGGCGTTTATATCCCAGTTTGACCCCTGAGGAACG
GGAGAGTATCGATAAGTTCGTCAACGAGCATACGGATGCCATTATAATCG
ATGGAGTTCCGATTCAGGGAGGTCGAAAGGCGAGGATCGTTGGAAAGATT
GTATCTCCAGGTGTGAAGGGCCTTGCAACTGGATTCTTTGAAGAATTGGG
TTCAAAGCTTGCTCAATTATTCACTGGTTAATATTGTTTTAATATTTGAG
TGAAAGAAAGGAAACAACAAAGTGACATATATAAGAAAGCTAATTTAATA
TTGACATGTAATTATTGCCACTTAACGTTTTGTATACAACTTTTAATTAA
TAATTTCAAATAAAATATCAATGCACATTAAAAAAAAAAAAAAAAAAA

RH28021.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
TotA.a 829 TotA.a 56..634 2..580 2895 100 Plus
TotA.b 1400 TotA.b 56..634 2..580 2895 100 Plus
TotA-RA 829 TotA-RA 56..634 2..580 2895 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16695065..16695579 65..579 2575 100 Plus
chr3R 27901430 chr3R 16696998..16697327 66..395 390 74.5 Plus
chr3R 27901430 chr3R 16694916..16694980 2..66 325 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20871186..20871701 65..580 2580 100 Plus
3R 32079331 3R 20873119..20873448 66..395 390 74.5 Plus
3R 32079331 3R 20871037..20871101 2..66 325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20612017..20612532 65..580 2580 100 Plus
3R 31820162 3R 20611868..20611932 2..66 325 100 Plus
3R 31820162 3R 20614160..20614279 276..395 240 80 Plus
3R 31820162 3R 20613950..20614104 66..220 220 76.1 Plus
3R 31820162 3R 20614898..20615032 72..206 165 74.8 Plus
Blast to na_te.dros performed 2019-03-15 20:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 1508..1580 569..491 110 65.8 Minus

RH28021.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:26:54 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16694915..16694978 1..64 98 -> Plus
chr3R 16695065..16695538 65..538 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:18 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 1..390 42..431 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:01 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 1..390 42..431 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:25 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 1..390 42..431 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:59 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 1..390 42..431 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:04 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 1..390 42..431 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:13 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 2..579 2..579 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:01 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 2..579 2..579 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:25 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 2..579 2..579 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:00 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 2..579 2..579 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:04 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
TotA-RA 2..579 2..579 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:54 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20871036..20871099 1..64 98 -> Plus
3R 20871186..20871700 65..579 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:54 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20871036..20871099 1..64 98 -> Plus
3R 20871186..20871700 65..579 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:54 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20871036..20871099 1..64 98 -> Plus
3R 20871186..20871700 65..579 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:25 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16696758..16696821 1..64 98 -> Plus
arm_3R 16696908..16697422 65..579 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:09:43 Download gff for RH28021.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20612017..20612531 65..579 100   Plus
3R 20611867..20611930 1..64 98 -> Plus

RH28021.hyp Sequence

Translation from 2 to 430

> RH28021.hyp
FRFASAFQKVITKMNSSTALMCFALLLISPLCMGYSDEDREADNLRIAEI
IKNAQDDDSKINSTQELLDIYRRLYPSLTPEERESIDKFVNEHTDAIIID
GVPIQGGRKARIVGKIVSPGVKGLATGFFEELGSKLAQLFTG*

RH28021.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
TotA-PA 129 CG31509-PA 1..129 14..142 651 100 Plus
TotC-PA 129 CG31508-PA 1..129 14..142 461 65.9 Plus
TotB-PA 138 CG5609-PA 1..127 14..141 348 52.3 Plus

RH28021.pep Sequence

Translation from 41 to 430

> RH28021.pep
MNSSTALMCFALLLISPLCMGYSDEDREADNLRIAEIIKNAQDDDSKINS
TQELLDIYRRLYPSLTPEERESIDKFVNEHTDAIIIDGVPIQGGRKARIV
GKIVSPGVKGLATGFFEELGSKLAQLFTG*

RH28021.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24221-PA 129 GG24221-PA 1..129 1..129 561 79.1 Plus
Dere\GG24210-PA 129 GG24210-PA 1..129 1..129 552 77.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
TotA-PA 129 CG31509-PA 1..129 1..129 651 100 Plus
TotC-PA 129 CG31508-PA 1..129 1..129 461 65.9 Plus
TotB-PA 138 CG5609-PA 1..127 1..128 348 52.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16288-PB 154 GA16288-PB 35..149 21..129 221 39.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23143-PA 129 GM23143-PA 1..129 1..129 610 87.6 Plus
Dsec\GM23142-PA 129 GM23142-PA 1..129 1..129 610 87.6 Plus
Dsec\GM23144-PA 129 GM23144-PA 1..129 1..129 490 67.4 Plus
Dsec\GM23145-PA 139 GM23145-PA 1..128 1..129 395 55.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19382-PA 129 GD19382-PA 1..129 1..129 611 88.4 Plus
Dsim\GD19381-PA 129 GD19381-PA 1..129 1..129 610 87.6 Plus
Dsim\GD19383-PA 129 GD19383-PA 1..129 1..129 490 67.4 Plus
Dsim\GD19384-PA 139 GD19384-PA 1..128 1..129 388 54.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25694-PA 129 GE25694-PA 1..129 1..129 564 80.6 Plus
Dyak\GE25695-PA 139 GE25695-PA 1..129 1..129 403 53.5 Plus
Dyak\GE18068-PA 140 GE18068-PA 1..109 1..109 339 53.2 Plus