RH28021.complete Sequence
598 bp (598 high quality bases) assembled on 2003-02-13
GenBank Submission: BT011049
> RH28021.complete
GATTCCGGTTTGCTTCAGCGTTCCAAAAAGTCATAACCAAAATGAATTCT
TCAACTGCTCTTATGTGCTTTGCACTGCTGCTGATTAGTCCTCTATGCAT
GGGCTATTCCGACGAAGATCGTGAGGCTGACAACCTTAGAATTGCTGAAA
TTATCAAAAACGCCCAGGACGATGACTCCAAAATCAATAGCACCCAGGAA
CTACTTGACATCTATAGGCGTTTATATCCCAGTTTGACCCCTGAGGAACG
GGAGAGTATCGATAAGTTCGTCAACGAGCATACGGATGCCATTATAATCG
ATGGAGTTCCGATTCAGGGAGGTCGAAAGGCGAGGATCGTTGGAAAGATT
GTATCTCCAGGTGTGAAGGGCCTTGCAACTGGATTCTTTGAAGAATTGGG
TTCAAAGCTTGCTCAATTATTCACTGGTTAATATTGTTTTAATATTTGAG
TGAAAGAAAGGAAACAACAAAGTGACATATATAAGAAAGCTAATTTAATA
TTGACATGTAATTATTGCCACTTAACGTTTTGTATACAACTTTTAATTAA
TAATTTCAAATAAAATATCAATGCACATTAAAAAAAAAAAAAAAAAAA
RH28021.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:52:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotA.a | 829 | TotA.a | 56..634 | 2..580 | 2895 | 100 | Plus |
TotA.b | 1400 | TotA.b | 56..634 | 2..580 | 2895 | 100 | Plus |
TotA-RA | 829 | TotA-RA | 56..634 | 2..580 | 2895 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:25:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 16695065..16695579 | 65..579 | 2575 | 100 | Plus |
chr3R | 27901430 | chr3R | 16696998..16697327 | 66..395 | 390 | 74.5 | Plus |
chr3R | 27901430 | chr3R | 16694916..16694980 | 2..66 | 325 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 20871186..20871701 | 65..580 | 2580 | 100 | Plus |
3R | 32079331 | 3R | 20873119..20873448 | 66..395 | 390 | 74.5 | Plus |
3R | 32079331 | 3R | 20871037..20871101 | 2..66 | 325 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 20612017..20612532 | 65..580 | 2580 | 100 | Plus |
3R | 31820162 | 3R | 20611868..20611932 | 2..66 | 325 | 100 | Plus |
3R | 31820162 | 3R | 20614160..20614279 | 276..395 | 240 | 80 | Plus |
3R | 31820162 | 3R | 20613950..20614104 | 66..220 | 220 | 76.1 | Plus |
3R | 31820162 | 3R | 20614898..20615032 | 72..206 | 165 | 74.8 | Plus |
Blast to na_te.dros performed 2019-03-15 20:25:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 1508..1580 | 569..491 | 110 | 65.8 | Minus |
RH28021.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:26:54 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 16694915..16694978 | 1..64 | 98 | -> | Plus |
chr3R | 16695065..16695538 | 65..538 | 100 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:18 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 1..390 | 42..431 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:01 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 1..390 | 42..431 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:25 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 1..390 | 42..431 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:59 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 1..390 | 42..431 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:04 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 1..390 | 42..431 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:13 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 2..579 | 2..579 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:01 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 2..579 | 2..579 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:25 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 2..579 | 2..579 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:00 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 2..579 | 2..579 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:04 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotA-RA | 2..579 | 2..579 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:54 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20871036..20871099 | 1..64 | 98 | -> | Plus |
3R | 20871186..20871700 | 65..579 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:54 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20871036..20871099 | 1..64 | 98 | -> | Plus |
3R | 20871186..20871700 | 65..579 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:54 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20871036..20871099 | 1..64 | 98 | -> | Plus |
3R | 20871186..20871700 | 65..579 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:25 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 16696758..16696821 | 1..64 | 98 | -> | Plus |
arm_3R | 16696908..16697422 | 65..579 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:09:43 Download gff for
RH28021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20612017..20612531 | 65..579 | 100 | | Plus |
3R | 20611867..20611930 | 1..64 | 98 | -> | Plus |
RH28021.hyp Sequence
Translation from 2 to 430
> RH28021.hyp
FRFASAFQKVITKMNSSTALMCFALLLISPLCMGYSDEDREADNLRIAEI
IKNAQDDDSKINSTQELLDIYRRLYPSLTPEERESIDKFVNEHTDAIIID
GVPIQGGRKARIVGKIVSPGVKGLATGFFEELGSKLAQLFTG*
RH28021.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotA-PA | 129 | CG31509-PA | 1..129 | 14..142 | 651 | 100 | Plus |
TotC-PA | 129 | CG31508-PA | 1..129 | 14..142 | 461 | 65.9 | Plus |
TotB-PA | 138 | CG5609-PA | 1..127 | 14..141 | 348 | 52.3 | Plus |
RH28021.pep Sequence
Translation from 41 to 430
> RH28021.pep
MNSSTALMCFALLLISPLCMGYSDEDREADNLRIAEIIKNAQDDDSKINS
TQELLDIYRRLYPSLTPEERESIDKFVNEHTDAIIIDGVPIQGGRKARIV
GKIVSPGVKGLATGFFEELGSKLAQLFTG*
RH28021.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:49:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24221-PA | 129 | GG24221-PA | 1..129 | 1..129 | 561 | 79.1 | Plus |
Dere\GG24210-PA | 129 | GG24210-PA | 1..129 | 1..129 | 552 | 77.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotA-PA | 129 | CG31509-PA | 1..129 | 1..129 | 651 | 100 | Plus |
TotC-PA | 129 | CG31508-PA | 1..129 | 1..129 | 461 | 65.9 | Plus |
TotB-PA | 138 | CG5609-PA | 1..127 | 1..128 | 348 | 52.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:50:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16288-PB | 154 | GA16288-PB | 35..149 | 21..129 | 221 | 39.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:50:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23143-PA | 129 | GM23143-PA | 1..129 | 1..129 | 610 | 87.6 | Plus |
Dsec\GM23142-PA | 129 | GM23142-PA | 1..129 | 1..129 | 610 | 87.6 | Plus |
Dsec\GM23144-PA | 129 | GM23144-PA | 1..129 | 1..129 | 490 | 67.4 | Plus |
Dsec\GM23145-PA | 139 | GM23145-PA | 1..128 | 1..129 | 395 | 55.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:50:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19382-PA | 129 | GD19382-PA | 1..129 | 1..129 | 611 | 88.4 | Plus |
Dsim\GD19381-PA | 129 | GD19381-PA | 1..129 | 1..129 | 610 | 87.6 | Plus |
Dsim\GD19383-PA | 129 | GD19383-PA | 1..129 | 1..129 | 490 | 67.4 | Plus |
Dsim\GD19384-PA | 139 | GD19384-PA | 1..128 | 1..129 | 388 | 54.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:50:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25694-PA | 129 | GE25694-PA | 1..129 | 1..129 | 564 | 80.6 | Plus |
Dyak\GE25695-PA | 139 | GE25695-PA | 1..129 | 1..129 | 403 | 53.5 | Plus |
Dyak\GE18068-PA | 140 | GE18068-PA | 1..109 | 1..109 | 339 | 53.2 | Plus |