Clone RH28596 Report

Search the DGRC for RH28596

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:285
Well:96
Vector:pFlc-1
Associated Gene/TranscriptCG14787-RA
Protein status:RH28596.pep: gold
Preliminary Size:843
Sequenced Size:877

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14787 2002-01-01 Sim4 clustering to Release 2
CG14787 2002-05-20 Blastp of sequenced clone
CG14787 2003-01-01 Sim4 clustering to Release 3
CG14787 2008-04-29 Release 5.5 accounting
CG14787 2008-08-15 Release 5.9 accounting
CG14787 2008-12-18 5.12 accounting

Clone Sequence Records

RH28596.complete Sequence

877 bp (877 high quality bases) assembled on 2002-05-20

GenBank Submission: AY118430

> RH28596.complete
GCTCTATCACGCAGTCTTCAGCGATGGCCACAAACGAGAGCTGCAAGCAC
TTCAGGGAGCTGGTCGTCGAACAGCGTTCTGGGCTGCTCCACATACGCTT
CCAGCGGCGCTGGCAACGCCGAACCCTCTACGAGCTGATGCGCGCCCTGG
ACCTGGCGAGTGCAGACGCCGCCGTTAAGGTGGTCGTGCTCTCGGGCGAG
TTTTCTGCAGCATGTGGCGGTGAGATGGAACCGTTGGCTCTCAAACAGGG
TCTGGAGAATAGGAGTAGGCGTACCGCTTCCCACGAAGAAGCTGTGGGCA
GTGGTGATGCCGAGGAGCAGTACATCCATGAGAAGGCGGCCAATTTTGTG
ATGCGCTCGCTGGCCAAGAAGCTGCTTGTGCACCGCAAACTCCTAGTGGC
TTTTGTGGAGAGGCAGTGCGTCGGTCTGGGCCTGAGCGTGTGCAGCCTGT
GCGATCTGGTCTTCGCAACGGAGTTATCTGCCTTTGTGCCCGCTTTCTCG
CACCTGGATCCCTGCACCAAGGTGGGTCCCGGCTGGACTGTGCCACACGT
CCACTGGCTGCTTCGTCTGGGCGATCAAGCGAGCTCCAGCATTGCCCTCC
AGTGTGGCCTTGTGGCCAGTGTGGTGCGAGAGCCGCAGGAGTTTTGGCAC
CGCGTCGACCAATACTTGCGCTTGCCTTCCGCCTCCCTGTTGGCGACAAA
GCGCCTCCTGTTTCGTCCCTGGCAGGACTCCCTCTTGGCCGAATTGCGCG
AGGAGGGCACTCCGCTGGCTGCGCAGCGACGCCGCTTGGCCAGATCCTCG
CTGTAGGGTTGCGCTTCCAGATCCGTTGAATCGATTAAGTAAATAAATAG
CGATTATAAAATAAAAAAAAAAAAAAA

RH28596.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14787-RA 861 CG14787-RA 1..861 2..862 4305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1354746..1355606 862..2 4275 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1460805..1461667 864..2 4315 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1468903..1469765 864..2 4315 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:54:20 has no hits.

RH28596.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:55:32 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1354746..1355606 1..862 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:20 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 1..783 24..806 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:02 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 1..783 24..806 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:06 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 1..783 24..806 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:23 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 1..783 24..806 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:38:11 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 1..783 24..806 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:03:36 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 1..861 2..862 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:02 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 1..861 2..862 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:06 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 8..870 1..862 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:23 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 1..861 2..862 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:38:11 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
CG14787-RA 8..870 1..862 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:32 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
X 1460807..1461667 1..862 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:32 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
X 1460807..1461667 1..862 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:32 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
X 1460807..1461667 1..862 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:06 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1354840..1355700 1..862 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:15:54 Download gff for RH28596.complete
Subject Subject Range Query Range Percent Splice Strand
X 1468905..1469765 1..862 99   Minus

RH28596.hyp Sequence

Translation from 2 to 805

> RH28596.hyp
SITQSSAMATNESCKHFRELVVEQRSGLLHIRFQRRWQRRTLYELMRALD
LASADAAVKVVVLSGEFSAACGGEMEPLALKQGLENRSRRTASHEEAVGS
GDAEEQYIHEKAANFVMRSLAKKLLVHRKLLVAFVERQCVGLGLSVCSLC
DLVFATELSAFVPAFSHLDPCTKVGPGWTVPHVHWLLRLGDQASSSIALQ
CGLVASVVREPQEFWHRVDQYLRLPSASLLATKRLLFRPWQDSLLAELRE
EGTPLAAQRRRLARSSL*

RH28596.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14787-PA 260 CG14787-PA 1..260 8..267 1330 100 Plus

RH28596.pep Sequence

Translation from 23 to 805

> RH28596.pep
MATNESCKHFRELVVEQRSGLLHIRFQRRWQRRTLYELMRALDLASADAA
VKVVVLSGEFSAACGGEMEPLALKQGLENRSRRTASHEEAVGSGDAEEQY
IHEKAANFVMRSLAKKLLVHRKLLVAFVERQCVGLGLSVCSLCDLVFATE
LSAFVPAFSHLDPCTKVGPGWTVPHVHWLLRLGDQASSSIALQCGLVASV
VREPQEFWHRVDQYLRLPSASLLATKRLLFRPWQDSLLAELREEGTPLAA
QRRRLARSSL*

RH28596.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21279-PA 260 GF21279-PA 1..260 1..260 813 61.8 Plus
Dana\GF24414-PA 260 GF24414-PA 2..227 6..238 166 23.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12699-PA 260 GG12699-PA 1..260 1..260 1182 90.4 Plus
Dere\GG14742-PA 262 GG14742-PA 2..227 6..238 162 22.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11876-PA 272 GH11876-PA 5..252 2..253 430 37.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14787-PA 260 CG14787-PA 1..260 1..260 1330 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15664-PA 275 GI15664-PA 17..257 8..252 460 41.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14379-PA 268 GL14379-PA 24..268 4..260 711 55.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13245-PA 252 GA13245-PA 8..252 4..260 715 55.6 Plus
Dpse\GA12604-PA 260 GA12604-PA 6..218 10..229 152 23.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18975-PA 243 GM18975-PA 1..243 1..260 1128 89.2 Plus
Dsec\GM14360-PA 262 GM14360-PA 6..240 10..251 171 23.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16421-PA 260 GD16421-PA 1..260 1..260 1223 94.6 Plus
Dsim\GD13579-PA 262 GD13579-PA 4..227 8..238 164 22.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19197-PA 274 GJ19197-PA 13..257 5..253 487 41.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25674-PA 247 GK25674-PA 2..244 3..254 407 40.3 Plus
Dwil\GK17361-PA 262 GK17361-PA 2..229 6..238 173 23 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16529-PA 334 GE16529-PA 1..243 1..243 1064 87.2 Plus
Dyak\GE21104-PA 262 GE21104-PA 2..227 6..238 168 22.7 Plus