BDGP Sequence Production Resources |
Search the DGRC for RH29440
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 294 |
Well: | 40 |
Vector: | pFlc-1 |
Associated Gene/Transcript | snRNP-U1-C-RA |
Protein status: | RH29440.pep: gold |
Preliminary Size: | 616 |
Sequenced Size: | 703 |
Gene | Date | Evidence |
---|---|---|
CG5454 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5454 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5454 | 2003-01-22 | Blastp of sequenced clone |
snRNP-U1 | 2008-04-29 | Release 5.5 accounting |
snRNP-U1 | 2008-08-15 | Release 5.9 accounting |
snRNP-U1 | 2008-12-18 | 5.12 accounting |
703 bp (703 high quality bases) assembled on 2003-01-22
GenBank Submission: BT003460
> RH29440.complete GCTCAGTAGCTTATCACCCTTGTCGAAATACGGTCATACGACTGCGAAAA ATAATAAATAAAACTACAGTGAACCGAATTTCCTTAGCTAAGATAAATAA ATTAGTGCAATGCCAAAGTACTATTGCGACTACTGCGACACCTACTTGAC CCACGACTCGCCCTCGGTGCGGAAAACCCACTGCACCGGCCGCAAGCATC GCGACAATGTAAAGTTCTACTACCAAAAGTGGATGGAGGAACAGGCGCAG CATTTGATTGACGCCACTACCGCCGCCTTCAAAGCGGGCAAGATCACGAA CAATCCGTTTGCCGGCGGGCCAGGAGGAGCGCCTCCCAAGCCGGCGGGCG TGTCTATTCCGCCGCCCAACATGGGGGCTCCTCCGCGTCCGGGAATGCCT GGAATGCCCTATATGCCTCCACTGATGAACCCCATGATGGGCATGCGTCC GCCACCGATTATGAATCCCATGGCCATGATGGGACCACCGCCTCCACTGG GCACTATACCCGGCGTCCGTCCAGGAATCATGAACGGACCCAAGTGAACG CCCTCAGGAACGGCATCAACGTTCACAGCACAGATGGAGTGCTCTCCTTG CGATGTCCTAATTAAGCTGTAGCATTTAAGTAAGCCCGATAGCGAAAACA ATTAATTATATACATTTATATAAAGCAAGTTGACTCGAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
snRNP-U1-RA | 693 | snRNP-U1-RA | 1..685 | 2..686 | 3410 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 14806884..14807565 | 686..5 | 3290 | 98.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 18982964..18983648 | 686..2 | 3410 | 99.9 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 18723795..18724479 | 686..2 | 3410 | 99.8 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14806883..14807568 | 1..687 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-RA | 1..438 | 110..547 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-C-RA | 1..438 | 110..547 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-C-RA | 1..438 | 110..547 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-RA | 1..438 | 110..547 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-C-RA | 1..438 | 110..547 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-RA | 1..685 | 2..687 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-C-RA | 1..685 | 2..687 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-C-RA | 1..685 | 2..686 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-RA | 1..685 | 2..687 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snRNP-U1-C-RA | 1..687 | 1..686 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18982963..18983648 | 1..687 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18982963..18983648 | 1..687 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18982963..18983648 | 1..687 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14808685..14809370 | 1..687 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18723794..18724479 | 1..687 | 99 | Minus |
Translation from 109 to 546
> RH29440.pep MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLI DATTAAFKAGKITNNPFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMP YMPPLMNPMMGMRPPPIMNPMAMMGPPPPLGTIPGVRPGIMNGPK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23008-PA | 147 | GF23008-PA | 1..147 | 1..145 | 444 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16240-PA | 145 | GG16240-PA | 1..145 | 1..145 | 735 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23369-PA | 144 | GH23369-PA | 1..121 | 1..119 | 464 | 81.5 | Plus |
Dgri\GH22525-PA | 144 | GH22525-PA | 1..121 | 1..119 | 464 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
snRNP-U1-C-PA | 145 | CG5454-PA | 1..145 | 1..145 | 831 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22226-PA | 144 | GI22226-PA | 1..121 | 1..119 | 459 | 79.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24104-PA | 146 | GL24104-PA | 1..146 | 1..145 | 518 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18892-PA | 146 | GA18892-PA | 1..146 | 1..145 | 518 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13647-PA | 145 | GM13647-PA | 1..145 | 1..145 | 740 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20140-PA | 145 | GD20140-PA | 1..145 | 1..145 | 740 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24347-PA | 144 | GJ24347-PA | 1..121 | 1..119 | 525 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12970-PA | 146 | GK12970-PA | 1..146 | 1..145 | 532 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25158-PA | 145 | GE25158-PA | 1..145 | 1..145 | 740 | 100 | Plus |
Translation from 109 to 546
> RH29440.hyp MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLI DATTAAFKAGKITNNPFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMP YMPPLMNPMMGMRPPPIMNPMAMMGPPPPLGTIPGVRPGIMNGPK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
snRNP-U1-C-PA | 145 | CG5454-PA | 1..145 | 1..145 | 831 | 100 | Plus |