Clone RH29440 Report

Search the DGRC for RH29440

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:294
Well:40
Vector:pFlc-1
Associated Gene/TranscriptsnRNP-U1-C-RA
Protein status:RH29440.pep: gold
Preliminary Size:616
Sequenced Size:703

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5454 2002-01-01 Sim4 clustering to Release 2
CG5454 2003-01-01 Sim4 clustering to Release 3
CG5454 2003-01-22 Blastp of sequenced clone
snRNP-U1 2008-04-29 Release 5.5 accounting
snRNP-U1 2008-08-15 Release 5.9 accounting
snRNP-U1 2008-12-18 5.12 accounting

Clone Sequence Records

RH29440.complete Sequence

703 bp (703 high quality bases) assembled on 2003-01-22

GenBank Submission: BT003460

> RH29440.complete
GCTCAGTAGCTTATCACCCTTGTCGAAATACGGTCATACGACTGCGAAAA
ATAATAAATAAAACTACAGTGAACCGAATTTCCTTAGCTAAGATAAATAA
ATTAGTGCAATGCCAAAGTACTATTGCGACTACTGCGACACCTACTTGAC
CCACGACTCGCCCTCGGTGCGGAAAACCCACTGCACCGGCCGCAAGCATC
GCGACAATGTAAAGTTCTACTACCAAAAGTGGATGGAGGAACAGGCGCAG
CATTTGATTGACGCCACTACCGCCGCCTTCAAAGCGGGCAAGATCACGAA
CAATCCGTTTGCCGGCGGGCCAGGAGGAGCGCCTCCCAAGCCGGCGGGCG
TGTCTATTCCGCCGCCCAACATGGGGGCTCCTCCGCGTCCGGGAATGCCT
GGAATGCCCTATATGCCTCCACTGATGAACCCCATGATGGGCATGCGTCC
GCCACCGATTATGAATCCCATGGCCATGATGGGACCACCGCCTCCACTGG
GCACTATACCCGGCGTCCGTCCAGGAATCATGAACGGACCCAAGTGAACG
CCCTCAGGAACGGCATCAACGTTCACAGCACAGATGGAGTGCTCTCCTTG
CGATGTCCTAATTAAGCTGTAGCATTTAAGTAAGCCCGATAGCGAAAACA
ATTAATTATATACATTTATATAAAGCAAGTTGACTCGAAAAAAAAAAAAA
AAA

RH29440.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
snRNP-U1-RA 693 snRNP-U1-RA 1..685 2..686 3410 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14806884..14807565 686..5 3290 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18982964..18983648 686..2 3410 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18723795..18724479 686..2 3410 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 09:42:32 has no hits.

RH29440.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:43:24 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14806883..14807568 1..687 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:26 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-RA 1..438 110..547 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:53:53 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-C-RA 1..438 110..547 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:04:29 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-C-RA 1..438 110..547 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:44:58 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-RA 1..438 110..547 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:46 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-C-RA 1..438 110..547 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:08:31 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-RA 1..685 2..687 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:53:53 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-C-RA 1..685 2..687 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:04:29 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-C-RA 1..685 2..686 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:44:58 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-RA 1..685 2..687 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:46 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP-U1-C-RA 1..687 1..686 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:24 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18982963..18983648 1..687 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:24 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18982963..18983648 1..687 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:24 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18982963..18983648 1..687 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:04:29 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14808685..14809370 1..687 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:15:53 Download gff for RH29440.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18723794..18724479 1..687 99   Minus

RH29440.pep Sequence

Translation from 109 to 546

> RH29440.pep
MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLI
DATTAAFKAGKITNNPFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMP
YMPPLMNPMMGMRPPPIMNPMAMMGPPPPLGTIPGVRPGIMNGPK*

RH29440.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23008-PA 147 GF23008-PA 1..147 1..145 444 79.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16240-PA 145 GG16240-PA 1..145 1..145 735 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23369-PA 144 GH23369-PA 1..121 1..119 464 81.5 Plus
Dgri\GH22525-PA 144 GH22525-PA 1..121 1..119 464 81.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
snRNP-U1-C-PA 145 CG5454-PA 1..145 1..145 831 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22226-PA 144 GI22226-PA 1..121 1..119 459 79.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24104-PA 146 GL24104-PA 1..146 1..145 518 84.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18892-PA 146 GA18892-PA 1..146 1..145 518 84.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13647-PA 145 GM13647-PA 1..145 1..145 740 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20140-PA 145 GD20140-PA 1..145 1..145 740 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24347-PA 144 GJ24347-PA 1..121 1..119 525 86.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12970-PA 146 GK12970-PA 1..146 1..145 532 86.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25158-PA 145 GE25158-PA 1..145 1..145 740 100 Plus

RH29440.hyp Sequence

Translation from 109 to 546

> RH29440.hyp
MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLI
DATTAAFKAGKITNNPFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMP
YMPPLMNPMMGMRPPPIMNPMAMMGPPPPLGTIPGVRPGIMNGPK*

RH29440.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
snRNP-U1-C-PA 145 CG5454-PA 1..145 1..145 831 100 Plus