Clone RH29451 Report

Search the DGRC for RH29451

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:294
Well:51
Vector:pFlc-1
Associated Gene/TranscriptDptB-RA
Protein status:RH29451.pep: gold
Sequenced Size:465

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10794 2002-11-06 Blastp of sequenced clone
CG10794 2003-01-01 Sim4 clustering to Release 3
DptB 2008-04-29 Release 5.5 accounting
DptB 2008-08-15 Release 5.9 accounting
DptB 2008-12-18 5.12 accounting

Clone Sequence Records

RH29451.complete Sequence

465 bp (465 high quality bases) assembled on 2002-11-06

GenBank Submission: BT001801

> RH29451.complete
GATTCAGTTGACAAAGCCTAATCAAATCAAAATGCATTTCACCGCTAGTC
TTCTATTCATTGGACTGGCTTGTGCCTTCTCGAGTGCCTGGGCTTATCCC
TATCCTGATCCCCGAGAGATTGTGAATCTGCAGCCTGAACCACTGGCATA
TGCTCCCAATTTTGATGTGCCCCTGCACAGAGTGCGTCGCCAGTTCCAAT
TGAATGGCGGTGGCGGTGGAAGCCCAAAGCAAGGATTCGATCTGAGCCTC
AACGGACGTGCTCCCGTTTGGCAGAGCCCCAATGGACGCCACTCCTTCGA
TGCCACGGGATCGTATGCCCAGCACCTTGGTGGACCCTATGGCAACAGCC
GGCCTCAGTGGGGAGCCGGTGGAGTGTATACCTTCAGGTTTTAGGGCACT
TCAGAAGCTACATAATTTTTATTAAATAAAATAAATTTATTACAATTACA
AAAAAAAAAAAAAAA

RH29451.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
DptB-RA 480 DptB-RA 33..480 2..449 2240 100 Plus
DptB.a 717 DptB.a 270..717 2..449 2240 100 Plus
DMG8-chr2R.27.007.a 324 DMG8-chr2R.27.007.a 275..324 451..402 250 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14754733..14755033 149..449 1430 98.3 Plus
chr2R 21145070 chr2R 14754530..14754676 2..148 675 97.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18867595..18867897 149..451 1515 100 Plus
2R 25286936 2R 18867392..18867538 2..148 735 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18868794..18869096 149..451 1515 100 Plus
2R 25260384 2R 18868591..18868737 2..148 735 100 Plus
Blast to na_te.dros performed 2019-03-15 20:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 58..104 448..404 112 76.6 Minus
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 314..342 441..413 109 86.2 Minus
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 351..425 442..368 105 63.6 Minus

RH29451.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:27:03 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14754528..14754676 1..148 96 -> Plus
chr2R 14754733..14754990 149..406 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:27 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:50:03 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:33 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:10 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:16 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:00:44 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 1..450 1..449 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:50:02 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 1..450 1..449 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:33 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 2..449 2..449 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:10 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 1..450 1..449 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:16 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 2..449 2..449 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:03 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18867390..18867538 1..148 99 -> Plus
2R 18867595..18867895 149..449 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:03 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18867390..18867538 1..148 99 -> Plus
2R 18867595..18867895 149..449 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:03 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18867390..18867538 1..148 99 -> Plus
2R 18867595..18867895 149..449 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:33 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14754895..14755043 1..148 99 -> Plus
arm_2R 14755100..14755400 149..449 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:12:01 Download gff for RH29451.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18868794..18869094 149..449 100   Plus
2R 18868589..18868737 1..148 99 -> Plus

RH29451.hyp Sequence

Translation from 0 to 393

> RH29451.hyp
IQLTKPNQIKMHFTASLLFIGLACAFSSAWAYPYPDPREIVNLQPEPLAY
APNFDVPLHRVRRQFQLNGGGGGSPKQGFDLSLNGRAPVWQSPNGRHSFD
ATGSYAQHLGGPYGNSRPQWGAGGVYTFRF*

RH29451.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
DptB-PA 120 CG10794-PA 1..120 11..130 668 100 Plus
Dpt-PA 106 CG12763-PA 1..103 11..130 240 41.7 Plus

RH29451.pep Sequence

Translation from 31 to 393

> RH29451.pep
MHFTASLLFIGLACAFSSAWAYPYPDPREIVNLQPEPLAYAPNFDVPLHR
VRRQFQLNGGGGGSPKQGFDLSLNGRAPVWQSPNGRHSFDATGSYAQHLG
GPYGNSRPQWGAGGVYTFRF*

RH29451.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11125-PA 123 GF11125-PA 1..123 1..120 443 75.6 Plus
Dana\GF11124-PA 99 GF11124-PA 52..99 73..120 158 60.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21935-PA 120 GG21935-PA 1..120 1..120 560 92.5 Plus
Dere\GG21934-PA 106 GG21934-PA 56..103 73..120 144 54.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22132-PA 117 GH22132-PA 32..117 33..120 312 72.7 Plus
Dgri\GH22133-PA 109 GH22133-PA 2..109 6..120 221 44 Plus
Dgri\GH22131-PA 109 GH22131-PA 2..109 6..120 221 44 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
DptB-PA 120 CG10794-PA 1..120 1..120 668 100 Plus
DptA-PA 106 CG12763-PA 1..103 1..120 240 41.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19362-PA 141 GI19362-PA 14..141 16..120 308 52.3 Plus
Dmoj\GI19360-PA 114 GI19360-PA 5..114 8..120 185 40 Plus
Dmoj\GI19361-PA 111 GI19361-PA 9..111 12..120 172 42.2 Plus
Dmoj\GI20150-PA 111 GI20150-PA 44..111 52..120 162 52.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11495-PA 125 GL11495-PA 26..125 22..120 326 72.5 Plus
Dper\GL11494-PA 102 GL11494-PA 1..102 3..120 170 33.9 Plus
Dper\GL11493-PA 102 GL11493-PA 1..102 3..120 164 33.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10563-PA 125 GA10563-PA 26..125 22..120 310 72.5 Plus
Dpse\GA11797-PA 102 GA11797-PA 1..102 3..120 169 33.9 Plus
Dpse\GA24749-PA 102 GA24749-PA 1..102 3..120 169 33.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21924-PA 120 GM21924-PA 1..120 1..120 615 96.7 Plus
Dsec\GM21923-PA 105 GM21923-PA 1..103 1..120 176 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11419-PA 120 GD11419-PA 1..120 1..120 615 96.7 Plus
Dsim\GD11418-PA 124 GD11418-PA 1..122 1..120 410 69.7 Plus
Dsim\GD11417-PA 84 GD11417-PA 35..82 73..120 149 56.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19917-PA 142 GJ19917-PA 14..142 13..120 311 55.6 Plus
Dvir\GJ19916-PA 111 GJ19916-PA 5..111 8..120 208 43.2 Plus
Dvir\GJ19915-PA 111 GJ19915-PA 5..111 8..120 208 43.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20932-PA 117 GK20932-PA 1..117 1..120 391 72.5 Plus
Dwil\GK20689-PA 112 GK20689-PA 1..111 1..114 309 64.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\DptB-PA 120 GE12008-PA 1..120 1..120 565 94.2 Plus
Dyak\Dpt-PA 106 GE12007-PA 1..103 1..120 165 40 Plus