Clone RH29859 Report

Search the DGRC for RH29859

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:298
Well:59
Vector:pFlc-1
Associated Gene/TranscriptMED18-RC
Protein status:RH29859.pep: gold
Preliminary Size:746
Sequenced Size:895

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14802 2002-01-01 Sim4 clustering to Release 2
CG14802 2002-05-18 Blastp of sequenced clone
CG14802 2003-01-01 Sim4 clustering to Release 3
MED18 2008-04-29 Release 5.5 accounting
MED18 2008-08-15 Release 5.9 accounting
MED18 2008-12-18 5.12 accounting

Clone Sequence Records

RH29859.complete Sequence

895 bp (895 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119167.1

> RH29859.complete
GACTAGTAAAACGAATTCTTCCAAGGAAATGAAACTAAAAACAAAACCAA
ACTACTGCTCAGTTAATTTAATACCATAGTACACCCAAACTTACAAAATT
AGCCAATGGCGATTGTGTCGTCGGCCCGTGAGTCGCTCTCCCATGCGATG
AACAACCGCTTCTTGCCCAACCTGGAGTACTTGCTGCAGGGATCTATCCT
GGATTCCGCCGTGGAACACTTGATGCACAGTCTAACCGCCTACCCACTAT
CAGACTAAAGGGACTCTGCGACAATGTGGACACCTCGCCGGAGCCGTTTC
ACGATCTGGAAGTGTGTATGAGCCTTCGCCAGCCCAATGCCAACCAGCCG
CTGCTTCTTCGCGTGCGCCGAGCCCTTGGTCGCGATGCACCCTTTCAGAT
GCGCTACCTAGGAAACCCCGAGGTGGATCTGCGCCGGCCTACATTGGTAC
GCAGCTGCATGGACTGCGCCTGCACCAATGGCATTTTGGAATTCCTCACG
GAAATGGGCTTCCGCCTGGAGTTCGAGTACATAGCAAAGGGCTATATGTT
CCGCAAGGGGCGCATGAAGATTACCGTCTCCAAGCTCATTAAGATTGTGC
CCGGCAAGCAGCAGGACATGGCCAACGAGCCAATCTCACAAAGCTACATA
GTGGAACTCTCTGTGGTGGCGCCAACGGGGCAGGAGAATGTCGGCGAGGA
AATGCGCGTGTTTGCCGAGCAACTAAAGCCACTCGTGCAGCTCGAGAAGA
TCGACTACAAGCGACTGGGCGGCATGCCGTAGTTTACAATAAAAGTGCAC
ATCGCATTTATCCAACAGTTATTTAATTTCTTAAATGTAAGAAAATATAC
AAATTTACAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

RH29859.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
MED18-RC 865 MED18-RC 2..864 2..864 4315 100 Plus
MED18.b 865 MED18.b 2..864 2..864 4315 100 Plus
MED18.a 928 MED18.a 603..927 540..864 1625 100 Plus
MED18.a 928 MED18.a 247..537 251..541 1455 100 Plus
MED18.a 928 MED18.a 21..254 2..235 1155 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1760405..1760725 540..860 1605 100 Plus
chrX 22417052 chrX 1760025..1760339 227..541 1575 100 Plus
chrX 22417052 chrX 1759753..1759981 2..230 1145 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1866562..1866886 540..864 1625 100 Plus
X 23542271 X 1866182..1866496 227..541 1575 100 Plus
X 23542271 X 1865910..1866138 2..230 1145 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1874660..1874984 540..864 1625 100 Plus
X 23527363 X 1874280..1874594 227..541 1575 100 Plus
X 23527363 X 1874008..1874236 2..230 1145 100 Plus
Blast to na_te.dros performed 2019-03-15 18:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
McClintock 6450 McClintock McCLINTOCK 6450bp 311..394 14..97 123 60.7 Plus
McClintock 6450 McClintock McCLINTOCK 6450bp 6263..6346 14..97 123 60.7 Plus
412 7567 412 412 7567bp 2351..2412 360..299 112 64.5 Minus

RH29859.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:51:24 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1759752..1759981 1..230 99 -> Plus
chrX 1760029..1760338 231..540 100 -> Plus
chrX 1760406..1760725 541..860 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:29 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 1..122 106..227 100 == Plus
MED18-RA 123..654 251..782 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:41:24 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 1..122 106..227 100 == Plus
MED18-RA 123..654 251..782 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:34:09 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 1..122 106..227 100 == Plus
MED18-RA 123..654 251..782 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:33:23 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 1..122 106..227 100 == Plus
MED18-RA 123..654 251..782 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:03:14 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 1..122 106..227 100 == Plus
MED18-RA 123..654 251..782 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:36 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RC 2..860 2..860 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:41:24 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RC 2..860 2..860 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:34:09 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RC 2..860 2..860 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:33:23 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RC 2..860 2..860 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:03:14 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RC 2..860 2..860 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:24 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
X 1865909..1866138 1..230 99 -> Plus
X 1866186..1866495 231..540 100 -> Plus
X 1866563..1866882 541..860 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:24 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
X 1865909..1866138 1..230 99 -> Plus
X 1866186..1866495 231..540 100 -> Plus
X 1866563..1866882 541..860 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:24 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
X 1865909..1866138 1..230 99 -> Plus
X 1866186..1866495 231..540 100 -> Plus
X 1866563..1866882 541..860 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:34:09 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1759942..1760171 1..230 99 -> Plus
arm_X 1760219..1760528 231..540 100 -> Plus
arm_X 1760596..1760915 541..860 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:05:48 Download gff for RH29859.complete
Subject Subject Range Query Range Percent Splice Strand
X 1874007..1874236 1..230 99 -> Plus
X 1874284..1874593 231..540 100 -> Plus
X 1874661..1874980 541..860 100   Plus

RH29859.pep Sequence

Translation from 105 to 257

> RH29859.pep
MAIVSSARESLSHAMNNRFLPNLEYLLQGSILDSAVEHLMHSLTAYPLSD
*

RH29859.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21201-PA 217 GF21201-PA 1..45 1..45 184 75.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12884-PA 217 GG12884-PA 1..45 1..45 214 93.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24653-PA 216 GH24653-PA 3..44 4..45 182 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
MED18-PC 50 CG14802-PC 1..50 1..50 248 100 Plus
MED18-PA 217 CG14802-PA 1..43 1..43 206 97.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11081-PA 217 GI11081-PA 3..44 4..45 165 76.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20340-PA 217 GL20340-PA 1..45 1..45 202 88.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13258-PA 217 GA13258-PA 1..45 1..45 199 86.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19171-PA 217 GM19171-PA 1..45 1..45 214 93.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16392-PA 216 GJ16392-PA 3..44 4..45 175 78.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10069-PA 219 GK10069-PA 3..47 1..45 192 84.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16712-PA 217 GE16712-PA 1..45 1..45 214 93.3 Plus

RH29859.hyp Sequence

Translation from 317 to 781

> RH29859.hyp
MSLRQPNANQPLLLRVRRALGRDAPFQMRYLGNPEVDLRRPTLVRSCMDC
ACTNGILEFLTEMGFRLEFEYIAKGYMFRKGRMKITVSKLIKIVPGKQQD
MANEPISQSYIVELSVVAPTGQENVGEEMRVFAEQLKPLVQLEKIDYKRL
GGMP*

RH29859.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
MED18-PA 217 CG14802-PA 64..217 1..154 790 100 Plus