Clone RH30069 Report

Search the DGRC for RH30069

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:300
Well:69
Vector:pFlc-1
Associated Gene/TranscriptCG3740-RA
Protein status:RH30069.pep: gold
Preliminary Size:674
Sequenced Size:828

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3740 2001-12-13 Blastp of sequenced clone
CG3740 2002-01-01 Sim4 clustering to Release 2
CG3740 2003-01-01 Sim4 clustering to Release 3
CG3740 2008-04-29 Release 5.5 accounting
CG3740 2008-08-15 Release 5.9 accounting
CG3740 2008-12-18 5.12 accounting

Clone Sequence Records

RH30069.complete Sequence

828 bp (828 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070694

> RH30069.complete
GATCTCTGAATCTGGCGCTCACAAGTTTAATCAAGTTGCTGTTTTTTAAG
TCAAATATAAGCTTTTTAATAGTTCCCTTCAAGCGGATTCCGTGAAATTG
TTTATGTTGTCGAGTAGCAAGTTGGAGAATTCAAGACCAACACTAAAAGG
CAGGATACAAACGGAACGGGTGGCGTAATCGGAAACGTCATACTGCCGCA
CGGAACAAAGTCTAAACAGGAAATACTAGCATAGCGTTGCGAAATTCGGG
CCAACTCCACGTAGCCTAAATATGCCCATAGATACGCGCGAGTTGATGGA
GGCGATAGCCATCGTAGCGGACGAGCGCAACGTCCGCGTCGCCGTCAAGC
AGTCCGGCAAGGGAGCGGCAATCTGCGCCGCCTGCTCCTTTGCGGGTGGC
ATGCTCCTGGGCCCCGTTGGGCTGGCGGTTGGCGGGGCCGCCGGCGGAAT
CGCCGCCTACAAGATGACAAGCGGCACATTCCGTCCGCTGGGCGAAGTCA
TCCTAAACGACCTGACGGACGCACAGCGAGAGCAGCTGGTGCAGCACGTA
ACCATGGCCGTGGCCGACATACATCCCACCGACGTGGTGATGCTGCTGCC
GCTGATTGTCCAGAACGCCTCCATTCAGCAGGCTGTGCTTAACACTGTCA
TGTCATTCGTGACCAACGAGTTGCGCATGCAGATTGTGGACTGACCTGCT
CTGCGGGCAAGTGGGCGATGGCCAGGTAACTGTAGAATTTGGACGGCTAT
CTCAGTCGAAACCTTTGTGATCAGTGTAGGTTTATTTATAATAATAAATA
CTTTATATGTACAAAAAAAAAAAAAAAA

RH30069.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3740-RA 1329 CG3740-RA 92..907 2..817 4065 99.8 Plus
dor-RA 3259 dor-RA 3200..3259 817..758 285 98.3 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1562650..1563122 474..2 2365 100 Minus
chrX 22417052 chrX 1562249..1562588 812..473 1700 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1668807..1669279 474..2 2365 100 Minus
X 23542271 X 1668401..1668745 817..473 1710 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1676905..1677377 474..2 2365 100 Minus
X 23527363 X 1676499..1676843 817..473 1710 99.7 Minus
Blast to na_te.dros performed on 2019-03-16 14:21:19 has no hits.

RH30069.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:22:10 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1562281..1562587 474..780 100 <- Minus
chrX 1562651..1563122 1..473 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:35 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 1..423 272..694 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:35 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 1..423 272..694 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:06:21 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 1..423 272..694 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:10 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 1..423 272..694 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:34 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 1..423 272..694 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:28 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 1..811 2..812 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:35 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 1..811 2..812 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:06:21 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 17..829 1..812 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:10 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 1..811 2..812 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:34 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
CG3740-RA 17..829 1..812 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:22:10 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
X 1668406..1668744 474..812 100 <- Minus
X 1668808..1669279 1..473 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:22:10 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
X 1668406..1668744 474..812 100 <- Minus
X 1668808..1669279 1..473 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:22:10 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
X 1668406..1668744 474..812 100 <- Minus
X 1668808..1669279 1..473 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:06:21 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1562439..1562777 474..812 100 <- Minus
arm_X 1562841..1563312 1..473 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:32 Download gff for RH30069.complete
Subject Subject Range Query Range Percent Splice Strand
X 1676504..1676842 474..812 100 <- Minus
X 1676906..1677377 1..473 99   Minus

RH30069.pep Sequence

Translation from 271 to 693

> RH30069.pep
MPIDTRELMEAIAIVADERNVRVAVKQSGKGAAICAACSFAGGMLLGPVG
LAVGGAAGGIAAYKMTSGTFRPLGEVILNDLTDAQREQLVQHVTMAVADI
HPTDVVMLLPLIVQNASIQQAVLNTVMSFVTNELRMQIVD*

RH30069.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22009-PA 140 GF22009-PA 1..140 1..140 617 94.3 Plus
Dana\GF18336-PA 137 GF18336-PA 6..137 8..140 223 44.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12688-PA 140 GG12688-PA 1..140 1..140 620 95 Plus
Dere\GG24365-PA 218 GG24365-PA 85..218 7..140 242 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17570-PA 140 GH17570-PA 1..140 1..140 578 85.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3740-PA 140 CG3740-PA 1..140 1..140 689 100 Plus
CG11671-PA 140 CG11671-PA 7..140 7..140 349 47.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16036-PA 140 GI16036-PA 1..140 1..140 602 90 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14368-PA 140 GL14368-PA 1..140 1..140 607 92.1 Plus
Dper\GL23423-PA 140 GL23423-PA 1..140 1..140 302 47.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17654-PA 140 GA17654-PA 1..140 1..140 607 92.1 Plus
Dpse\GA11134-PA 140 GA11134-PA 1..140 1..140 311 48.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18961-PA 140 GM18961-PA 1..140 1..140 711 98.6 Plus
Dsec\GM23716-PA 140 GM23716-PA 7..140 7..140 247 47.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24633-PA 140 GD24633-PA 1..140 1..140 709 97.9 Plus
Dsim\GD18531-PA 110 GD18531-PA 7..92 7..92 172 57 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15545-PA 140 GJ15545-PA 1..140 1..140 583 87.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10097-PA 140 GK10097-PA 1..140 1..140 576 87.1 Plus
Dwil\GK10098-PA 140 GK10098-PA 1..140 1..140 418 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16519-PA 140 GE16519-PA 1..140 1..140 687 94.3 Plus
Dyak\GE25861-PA 140 GE25861-PA 6..140 6..140 290 47.4 Plus

RH30069.hyp Sequence

Translation from 271 to 693

> RH30069.hyp
MPIDTRELMEAIAIVADERNVRVAVKQSGKGAAICAACSFAGGMLLGPVG
LAVGGAAGGIAAYKMTSGTFRPLGEVILNDLTDAQREQLVQHVTMAVADI
HPTDVVMLLPLIVQNASIQQAVLNTVMSFVTNELRMQIVD*

RH30069.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG3740-PA 140 CG3740-PA 1..140 1..140 689 100 Plus
CG11671-PA 140 CG11671-PA 7..140 7..140 349 47.8 Plus