Clone RH30329 Report

Search the DGRC for RH30329

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:303
Well:29
Vector:pFlc-1
Associated Gene/TranscriptFer1-RA
Protein status:RH30329.pep: gold
Preliminary Size:531
Sequenced Size:1451

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10066 2002-01-01 Sim4 clustering to Release 2
CG33323 2002-02-27 Blastp of sequenced clone
Fer1 2008-04-29 Release 5.5 accounting
Fer1 2008-08-15 Release 5.9 accounting
Fer1 2008-12-18 5.12 accounting

Clone Sequence Records

RH30329.complete Sequence

1451 bp assembled on 2007-04-17

GenBank Submission: AY089664

> RH30329.complete
GATTCGCTTCCCGGCAGTCAGAGAGTTCGCAACACGGCGCGTTTCGATGT
TAGAGTGCGCGGCATCGTTGCATCTATAAAGATTACTGGGGTGTTGGCCA
CTGGGAAATAACTATATTATAATTGGTTCGCGAGTGCGGAGTGTTTACTG
CTTAGGTGATGTGCAATTCGAAAGGTTACTGTGGTGAACCATTTCGTAGA
GGTTGAGAAAGCATCGGAATTATTTTGAACCAAGTCTAGTCAGAGGATTA
TAGCAAACTCCTAGAAAGGCAAAAGTCAAGGACGAAGAACACACGTTTCA
CTTGTTCAGCCTGCTACACCCCCTCCAGAATCTCAAACCTTGTGACACGT
GCTGGTCACGCGTCGCCAATCAGCGGATCGGAAGTGTTAGCTTTACCGTT
ATGCACTTAACTGGCAATTAGGCACACAAACAGAAGCGCAACAGATTTAC
CATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACT
TCTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTAT
TTTTTTGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTA
TAGCAGTGGCTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGCGGA
GCCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGG
CAGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGC
GTTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGAC
TAAGCAAGGTGGACACACTCAAGCTGGCCATAAGCTACATAACCTTCCTC
AGCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCT
GCAGCGTAACTACCAAAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATC
GCACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGA
TATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCACG
GGGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATC
AGAATCAAAACAGCAACCAGAGCAGCGACGATTTCAGCGGAAGTGGTGCG
GATATGTCGGATCCTGGAGCTGCGGCCAGTATTTTCAGCAGCGGCAGTGG
CATGTGAGTCTCGCAGGACTCGCTGGCGTGGCAAAGTCCTGAAACGAGTC
ACTGAGAATGAGATTCATTGGAAATCCTACTAGTCAAGCCTTGCTAGTCC
TGGCATCTAACACATATTAACCAACTTAATAATTATATGAAGAAAACATG
TTCTGTGGTATTTAATTGCTCTAAGTTCGCTAATATCTAAATGTTATACA
TAGTGGTTTAGTTTAAATCGAATAAACATTTCACACAAAAAAAAAAAAAA
A

RH30329.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
Fer1-RA 1717 Fer1-RA 155..1592 2..1439 7175 99.9 Plus
Fer1.a 1524 Fer1.a 659..1455 643..1439 3985 100 Plus
Fer1.a 1524 Fer1.a 3..644 2..643 3195 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2967549..2968031 954..1436 2415 100 Plus
chr3R 27901430 chr3R 2963036..2963415 263..642 1885 99.7 Plus
chr3R 27901430 chr3R 2962267..2962529 2..264 1300 99.6 Plus
chr3R 27901430 chr3R 2963480..2963647 643..810 840 100 Plus
chr3R 27901430 chr3R 2963907..2964053 807..953 735 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7141490..7141975 954..1439 2430 100 Plus
3R 32079331 3R 7136977..7137356 263..642 1900 100 Plus
3R 32079331 3R 7136208..7136470 2..264 1300 99.6 Plus
3R 32079331 3R 7137421..7137588 643..810 840 100 Plus
3R 32079331 3R 7137848..7137994 807..953 735 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6882321..6882806 954..1439 2430 100 Plus
3R 31820162 3R 6877808..6878187 263..642 1900 100 Plus
3R 31820162 3R 6877039..6877301 2..264 1300 99.6 Plus
3R 31820162 3R 6878252..6878419 643..810 840 100 Plus
3R 31820162 3R 6878679..6878825 807..953 735 100 Plus
Blast to na_te.dros performed 2019-03-15 18:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6791..6853 1081..1143 134 71.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6770..6883 1081..1197 126 61 Plus

RH30329.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:22:10 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2962265..2962529 1..264 99 -> Plus
chr3R 2963038..2963415 265..642 99 -> Plus
chr3R 2963480..2963645 643..808 100 -> Plus
chr3R 2963909..2964053 809..953 100 -> Plus
chr3R 2967549..2968031 954..1436 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:39 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..756 452..1207 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:19:10 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..756 452..1207 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:59:47 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..756 452..1207 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:15:35 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..756 452..1207 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:59 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..756 452..1207 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:34:50 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..1437 1..1436 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:19:10 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..1435 2..1436 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:59:47 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..1437 1..1436 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:15:35 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..1437 1..1436 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:59 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1-RA 1..1437 1..1436 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:10 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7136206..7136470 1..264 99 -> Plus
3R 7136979..7137356 265..642 100 -> Plus
3R 7137421..7137586 643..808 100 -> Plus
3R 7137850..7137994 809..953 100 -> Plus
3R 7141490..7141972 954..1436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:10 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7136206..7136470 1..264 99 -> Plus
3R 7136979..7137356 265..642 100 -> Plus
3R 7137421..7137586 643..808 100 -> Plus
3R 7137850..7137994 809..953 100 -> Plus
3R 7141490..7141972 954..1436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:10 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7136206..7136470 1..264 99 -> Plus
3R 7136979..7137356 265..642 100 -> Plus
3R 7137421..7137586 643..808 100 -> Plus
3R 7137850..7137994 809..953 100 -> Plus
3R 7141490..7141972 954..1436 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:59:47 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2961928..2962192 1..264 99 -> Plus
arm_3R 2963143..2963308 643..808 100 -> Plus
arm_3R 2963572..2963716 809..953 100 -> Plus
arm_3R 2962701..2963078 265..642 100 -> Plus
arm_3R 2967212..2967694 954..1436 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:08:05 Download gff for RH30329.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6878681..6878825 809..953 100 -> Plus
3R 6877037..6877301 1..264 99 -> Plus
3R 6877810..6878187 265..642 100 -> Plus
3R 6878252..6878417 643..808 100 -> Plus
3R 6882321..6882803 954..1436 100   Plus

RH30329.pep Sequence

Translation from 451 to 1206

> RH30329.pep
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M*

RH30329.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17655-PA 251 GF17655-PA 1..251 1..251 1181 95.6 Plus
Dana\GF18852-PA 278 GF18852-PA 141..211 76..140 220 59.2 Plus
Dana\GF16621-PA 195 GF16621-PA 70..143 55..137 199 51.8 Plus
Dana\GF13559-PA 486 GF13559-PA 355..413 78..137 162 55 Plus
Dana\GF14839-PA 199 GF14839-PA 137..198 79..140 152 46.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13863-PA 251 GG13863-PA 1..251 1..251 1345 100 Plus
Dere\GG20146-PA 279 GG20146-PA 142..212 76..140 220 59.2 Plus
Dere\GG17199-PA 195 GG17199-PA 87..142 82..137 197 60.7 Plus
Dere\twi-PA 489 GG22820-PA 358..416 78..137 163 55 Plus
Dere\GG23955-PA 174 GG23955-PA 54..119 77..142 162 47 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19006-PA 262 GH19006-PA 1..262 1..251 1094 85.6 Plus
Dgri\GH18836-PA 283 GH18836-PA 146..213 76..137 206 58.8 Plus
Dgri\GH19315-PA 197 GH19315-PA 85..140 82..137 197 60.7 Plus
Dgri\GH13020-PA 175 GH13020-PA 62..122 81..141 163 50.8 Plus
Dgri\GH20971-PA 526 GH20971-PA 388..446 78..137 162 55 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Fer1-PA 251 CG33323-PA 1..251 1..251 1316 100 Plus
Fer1-PB 256 CG33323-PB 1..256 1..251 1300 98 Plus
Fer2-PE 273 CG5952-PE 142..207 76..140 211 63.6 Plus
Fer2-PB 274 CG5952-PB 142..207 76..140 211 63.6 Plus
Fer2-PC 279 CG5952-PC 142..212 76..140 206 59.2 Plus
Fer2-PD 283 CG5952-PD 142..216 76..140 202 56 Plus
Fer3-PA 195 CG6913-PA 69..169 55..159 198 41.8 Plus
twi-PC 490 CG2956-PC 290..465 3..185 176 33.7 Plus
twi-PB 490 CG2956-PB 290..465 3..185 176 33.7 Plus
twi-PA 490 CG2956-PA 290..465 3..185 176 33.7 Plus
CG33557-PA 150 CG33557-PA 2..134 23..157 153 30.9 Plus
ato-PA 312 CG7508-PA 175..312 19..138 153 34.1 Plus
Hand-PA 174 CG18144-PA 54..117 77..140 152 48.4 Plus
amos-PA 198 CG10393-PA 136..197 79..140 148 46.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23061-PA 278 GI23061-PA 1..215 1..213 985 92.1 Plus
Dmoj\GI10095-PA 281 GI10095-PA 144..214 76..140 213 57.7 Plus
Dmoj\GI23534-PA 187 GI23534-PA 78..133 82..137 197 60.7 Plus
Dmoj\GI23536-PA 199 GI23536-PA 88..143 82..137 197 60.7 Plus
Dmoj\GI18263-PA 170 GI18263-PA 55..119 78..142 163 47.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12422-PA 253 GL12422-PA 1..253 1..251 1185 94.1 Plus
Dper\GL12402-PA 284 GL12402-PA 147..217 76..140 220 59.2 Plus
Dper\GL12254-PA 190 GL12254-PA 63..129 62..137 197 52.6 Plus
Dper\GL18976-PA 173 GL18976-PA 57..124 81..150 164 50 Plus
Dper\GL11229-PA 510 GL11229-PA 375..433 78..137 162 55 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27498-PA 253 GA27498-PA 1..253 1..251 1185 94.1 Plus
Dpse\GA19254-PA 284 GA19254-PA 147..217 76..140 220 59.2 Plus
Dpse\GA19952-PA 205 GA19952-PA 89..144 82..137 196 60.7 Plus
Dpse\GA14815-PA 173 GA14815-PA 57..124 81..150 164 50 Plus
Dpse\twi-PA 510 GA15541-PA 375..433 78..137 162 55 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10936-PA 247 GM10936-PA 1..247 1..251 1293 97.2 Plus
Dsec\GM25729-PA 279 GM25729-PA 142..212 76..140 220 59.2 Plus
Dsec\GM26078-PA 245 GM26078-PA 137..192 82..137 197 60.7 Plus
Dsec\GM11834-PA 171 GM11834-PA 51..116 77..142 163 47 Plus
Dsec\GM15978-PA 488 GM15978-PA 357..415 78..137 162 55 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19915-PA 251 GD19915-PA 1..251 1..251 1345 100 Plus
Dsim\GD20306-PA 279 GD20306-PA 142..212 76..140 220 59.2 Plus
Dsim\GD20641-PA 195 GD20641-PA 87..142 82..137 197 60.7 Plus
Dsim\GD22284-PA 174 GD22284-PA 54..119 77..142 163 47 Plus
Dsim\twi-PA 476 GD11731-PA 345..403 78..137 162 55 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24574-PA 261 GJ24574-PA 1..261 1..251 1102 85.8 Plus
Dvir\GJ23831-PA 278 GJ23831-PA 147..211 82..140 210 60 Plus
Dvir\GJ10284-PA 198 GJ10284-PA 87..142 82..137 197 60.7 Plus
Dvir\twi-PA 522 GJ21576-PA 390..448 78..137 163 55 Plus
Dvir\GJ17522-PA 133 GJ17522-PA 21..77 81..137 154 52.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14521-PA 247 GK14521-PA 1..231 1..231 1007 92.7 Plus
Dwil\GK14012-PA 285 GK14012-PA 148..218 76..140 207 56.3 Plus
Dwil\GK11993-PA 198 GK11993-PA 87..142 82..137 197 60.7 Plus
Dwil\GK19547-PA 515 GK19547-PA 379..437 78..137 162 55 Plus
Dwil\GK24655-PA 198 GK24655-PA 136..197 79..140 153 46.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24907-PA 251 GE24907-PA 1..251 1..251 1339 99.2 Plus
Dyak\GE26333-PA 279 GE26333-PA 142..212 76..140 220 59.2 Plus
Dyak\GE10092-PA 226 GE10092-PA 118..173 82..137 197 60.7 Plus
Dyak\GE26185-PA 174 GE26185-PA 54..119 77..142 163 47 Plus
Dyak\twi-PA 491 GE14255-PA 360..418 78..137 162 55 Plus

RH30329.hyp Sequence

Translation from 451 to 1206

> RH30329.hyp
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M*

RH30329.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Fer1-PA 251 CG33323-PA 1..251 1..251 1316 100 Plus
Fer1-PB 256 CG33323-PB 1..256 1..251 1300 98 Plus
Fer2-PE 273 CG5952-PE 142..207 76..140 211 63.6 Plus
Fer2-PB 274 CG5952-PB 142..207 76..140 211 63.6 Plus
Fer2-PC 279 CG5952-PC 142..212 76..140 206 59.2 Plus