Clone RH31634 Report

Search the DGRC for RH31634

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:316
Well:34
Vector:pFlc-1
Associated Gene/TranscriptDro-RA
Protein status:RH31634.pep: gold
Preliminary Size:195
Sequenced Size:775

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10816 2002-01-01 Sim4 clustering to Release 2
CG10816 2003-01-01 Sim4 clustering to Release 3
Dro 2008-04-29 Release 5.5 accounting
Dro 2008-08-15 Release 5.9 accounting
Dro 2008-12-18 5.12 accounting

Clone Sequence Records

RH31634.complete Sequence

775 bp (775 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113579.1

> RH31634.complete
GAATCAGTTCGATTTGTCCACCACTCCAAGCACAATGAAGTTCACCATCG
TTTTCCTGCTGCTTGCTTGCGTTTTTGCCATGGGTGTGGCCACTCCCGGC
AAGCCACGCCCCTACAGCCCACGCCCCACCTCCCATCCCCGCCCCATTCG
GGTGAGGCGCGAGGCACTGGCCATCGAGGATCACCTGACTCAAGCTGCCA
TCAGGCCACCACCCATTCTGCCCGCCTAAAGATGTGTGCATACCGCGGAG
AAGTCATCCGATCAAATTTGTTTTGAAAAATCTTTATAAAAATTGTGAAT
TTTTTACTTTCTGCAAACAGTAAGCAATAAACACACGAAAGACAGCAATT
AATAATCTTCAATCAATTGTGACACAATGAGGGGTTCCCATCGCTTATCA
GCGGTTTTTGTACCGAATCTGCTGAGCTCTAGAGCTGATAAGAAATATAC
TTGCTCAAAACAAAACCACAAAAGTCACGTTTGAGAGAAAAAAAGCCTAA
ACGAATTTAATTCGCGACTCATATGAATCACAAACCTGTTCTATAGCACG
TTCTTCTTAAATTCTAGCGAAATAACCAGATGGCTGCAAATCATAATGAA
TGGGTTTGTCCCCTAAAAAAAACGAACTGACAAGCCCCCTTATAAAACTT
ATTTATTAATAGATTAGTTCGTATATAATTGCATATGTAAATACTTTAAA
TAGAACAAATTATTACGACATTTAAAAATATATATCCTGGTTTTTAAAAA
CAGGGTTTGAAAAAAAAAAAAAAAA

RH31634.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dro-RA 361 Dro-RA 2..361 2..361 1785 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10633240..10633997 2..759 3640 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14745957..14746721 2..766 3810 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14747156..14747920 2..766 3810 99.8 Plus
Blast to na_te.dros performed 2019-03-17 00:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
FB 1106 FB DMTNFB 1106bp AKA(J01084) Derived from V00246 (g8708) (Rel. 36, Last updated, Version 3). 479..525 688..734 118 72.3 Plus
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 3742..3800 679..735 110 67.8 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 4996..5092 430..523 108 59.8 Plus

RH31634.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:08:04 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10633239..10633997 1..759 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:53 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 1..195 35..229 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:57 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 1..195 35..229 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:30:48 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 1..195 35..229 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:27 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 1..195 35..229 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:12:31 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 1..195 35..229 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:35 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 2..759 2..759 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:57 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 2..361 2..361 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:30:48 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RB 1..754 6..759 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:27 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 2..759 2..759 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:31 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RB 1..754 6..759 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:04 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14745956..14746714 1..759 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:04 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14745956..14746714 1..759 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:04 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14745956..14746714 1..759 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:30:48 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10633461..10634219 1..759 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:04 Download gff for RH31634.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14747155..14747913 1..759 99   Plus

RH31634.hyp Sequence

Translation from 0 to 275

> RH31634.hyp
KSVRFVHHSKHNEVHHRFPAACLRFCHGCGHSRQATPLQPTPHLPSPPHS
SEARGTGHRGSPDSSCHQATTHSARLKMCAYRGEVIRSNLF*
Sequence RH31634.hyp has no blast hits.

RH31634.pep Sequence

Translation from 1 to 228

> RH31634.pep
NQFDLSTTPSTMKFTIVFLLLACVFAMGVATPGKPRPYSPRPTSHPRPIR
VRREALAIEDHLTQAAIRPPPILPA*

RH31634.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11338-PA 68 GF11338-PA 1..67 12..74 269 82.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20474-PA 64 GG20474-PA 1..63 12..74 294 93.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dro-PB 64 CG10816-PB 1..64 12..75 335 100 Plus
Dro-PA 64 CG10816-PA 1..64 12..75 335 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11457-PA 68 GL11457-PA 1..68 12..75 208 64.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10577-PA 68 GA10577-PA 1..68 12..75 210 66.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21566-PA 64 GM21566-PA 1..64 12..75 311 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Dro-PA 64 GD11071-PA 1..64 12..75 301 93.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19342-PA 56 GK19342-PA 1..44 12..54 164 75 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13605-PA 64 GE13605-PA 1..64 12..75 295 92.2 Plus