Clone RH32180 Report

Search the DGRC for RH32180

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:321
Well:80
Vector:pFlc-1
Associated Gene/TranscriptCG5697-RA
Protein status:RH32180.pep: gold
Preliminary Size:606
Sequenced Size:1004

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5697 2002-01-01 Sim4 clustering to Release 2
CG5697 2002-04-26 Blastp of sequenced clone
CG5697 2003-01-01 Sim4 clustering to Release 3
CG5697 2008-04-29 Release 5.5 accounting
CG5697 2008-08-15 Release 5.9 accounting
CG5697 2008-12-18 5.12 accounting

Clone Sequence Records

RH32180.complete Sequence

1004 bp (1004 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113581

> RH32180.complete
GGCCAGTAGTCCGCCAGTTGCGAATGGAGCAATTTCCAGCCGGGAGTGTT
TGCAATCCTGGTACTATCCCGTGAGAAGGGCTGAAAAAGGACTGTAAAAT
ACCCAGTTCCCATCTATAGTTATCTGTCGTGCCTGCAAGGGGCTACGGCA
ACTTTGGTGATAAAGTTACATAAACTGCGTATACCCTCTTGTTCGGCACA
CATCCAGGGTACCACACGGCAAATATGTCCTGCAACGAGAAGACAGCGCT
TCTGGCAACGCAACAAGGACATCAGCAGCGGCAGCAGCGGCAGCAGCAGC
ACATCATTGTCGTGCCCGCGACGGGGAAGGATCCAAAGGATTATGAGCCC
ATTTTCACAACTGCTGACTATTCCTACGGACTGACGCTCGAGGAGCTCCT
GCCCTTCGCTCTGGATCCCTGGTGGCAGGCCGTACGGCGCCTCAGCTGCG
GGCTCCTGGGCCTGACTTTCCTGCTGACCCTGATTGCTGGACTGGTTATG
GCCTATTCCGACAGTGTCTGTCTCCCAAATAGAGCAATTAGCAGAAACGC
GACCACCACGACAACGATGGCCACGCCACTATCCTTGGCTCTCAACGGCT
CCCAGCTGCTGATGGCCAGTTTATAGTGGCCGTAAGCTAATCTGTGTAGC
ATTTTGGAGATGCCGCAATCCACCCTGCGGAATTGCATCAGCCGCATCAG
CTCGCACTATTAGCATTTGTTTGGCTTGCCGGTAATGGAGGCGACCTAAT
CCTCCTCCTCTCTACTGTTTACCCCTACTCAAGCTGAGTGATAAGCGATG
CACCGCGGGATTGATTGGTCGTGAAATAATTATACTGATTAACTTATTTG
CTACACAACCGCCTACTCGTAAAGTAAAAAGAATGCAAAAGGTATAAGGA
AGCGTTTCCGTACCAATTAAGAACATTGTATCGCAAACTTATTAATTTTT
ATATATATACATATATATATATGAATATTACTTAAACCAAAAAAAAAAAA
AAAA

RH32180.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5697-RA 1028 CG5697-RA 22..1014 2..994 4935 99.7 Plus
CG5697.c 984 CG5697.c 2..984 2..987 4860 99.6 Plus
CG5697.a 1012 CG5697.a 393..1012 368..987 3100 100 Plus
CG5697.a 1012 CG5697.a 2..367 2..367 1830 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16840360..16840979 368..987 3100 100 Plus
chr3R 27901430 chr3R 16840078..16840286 159..367 1045 100 Plus
chr3R 27901430 chr3R 16839809..16839966 2..159 790 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21016501..21017127 368..994 3105 99.7 Plus
3R 32079331 3R 21016219..21016427 159..367 1045 100 Plus
3R 32079331 3R 21015950..21016107 2..159 790 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20757332..20757958 368..994 3105 99.6 Plus
3R 31820162 3R 20757050..20757258 159..367 1045 100 Plus
3R 31820162 3R 20756781..20756938 2..159 790 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:28:06 has no hits.

RH32180.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:29:00 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16839808..16839966 1..159 99 -> Plus
chr3R 16840079..16840286 160..367 86 -> Plus
chr3R 16840360..16840936 368..944 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:57 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RA 1..402 225..626 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:53:17 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RA 1..402 225..626 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:51:51 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RB 1..402 225..626 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:45:48 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RA 1..402 225..626 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:28:03 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RB 1..402 225..626 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:31:40 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RA 2..987 2..987 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:53:16 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RA 2..987 2..987 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:51:51 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RA 2..987 2..987 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:45:49 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RA 2..987 2..987 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:28:03 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
CG5697-RA 2..987 2..987 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:29:00 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21016220..21016427 160..367 100 -> Plus
3R 21015949..21016107 1..159 99 -> Plus
3R 21016501..21017120 368..988 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:29:00 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21016220..21016427 160..367 100 -> Plus
3R 21015949..21016107 1..159 99 -> Plus
3R 21016501..21017120 368..988 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:29:00 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21016220..21016427 160..367 100 -> Plus
3R 21015949..21016107 1..159 99 -> Plus
3R 21016501..21017120 368..988 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:51:51 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16841671..16841829 1..159 99 -> Plus
arm_3R 16841942..16842149 160..367 100 -> Plus
arm_3R 16842223..16842842 368..988 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:18:20 Download gff for RH32180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20757332..20757951 368..988 99   Plus
3R 20757051..20757258 160..367 100 -> Plus
3R 20756780..20756938 1..159 99 -> Plus

RH32180.pep Sequence

Translation from 224 to 625

> RH32180.pep
MSCNEKTALLATQQGHQQRQQRQQQHIIVVPATGKDPKDYEPIFTTADYS
YGLTLEELLPFALDPWWQAVRRLSCGLLGLTFLLTLIAGLVMAYSDSVCL
PNRAISRNATTTTTMATPLSLALNGSQLLMASL*

RH32180.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18000-PA 137 GF18000-PA 1..137 1..133 487 71.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24288-PA 129 GG24288-PA 1..129 1..133 544 89.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21735-PA 135 GH21735-PA 1..135 1..132 272 53.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG5697-PD 133 CG5697-PD 1..133 1..133 682 100 Plus
CG5697-PC 133 CG5697-PC 1..133 1..133 682 100 Plus
CG5697-PB 133 CG5697-PB 1..133 1..133 682 100 Plus
CG5697-PA 133 CG5697-PA 1..133 1..133 682 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10757-PA 132 GI10757-PA 1..94 1..94 266 62.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24292-PA 922 GL24292-PA 816..922 42..133 263 51.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19065-PA 140 GA19065-PA 1..140 1..133 429 60.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15057-PA 128 GM15057-PA 1..128 1..133 443 88.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19390-PA 129 GD19390-PA 1..129 1..133 621 94 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10699-PA 127 GJ10699-PA 1..124 1..129 351 59.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11952-PA 132 GK11952-PA 1..132 1..133 349 57.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25702-PA 129 GE25702-PA 1..128 1..132 525 86.4 Plus
Dyak\GE11222-PA 129 GE11222-PA 1..128 1..132 525 86.4 Plus

RH32180.hyp Sequence

Translation from 224 to 625

> RH32180.hyp
MSCNEKTALLATQQGHQQRQQRQQQHIIVVPATGKDPKDYEPIFTTADYS
YGLTLEELLPFALDPWWQAVRRLSCGLLGLTFLLTLIAGLVMAYSDSVCL
PNRAISRNATTTTTMATPLSLALNGSQLLMASL*

RH32180.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5697-PD 133 CG5697-PD 1..133 1..133 682 100 Plus
CG5697-PC 133 CG5697-PC 1..133 1..133 682 100 Plus
CG5697-PB 133 CG5697-PB 1..133 1..133 682 100 Plus
CG5697-PA 133 CG5697-PA 1..133 1..133 682 100 Plus