BDGP Sequence Production Resources |
Search the DGRC for RH32180
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 321 |
Well: | 80 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG5697-RA |
Protein status: | RH32180.pep: gold |
Preliminary Size: | 606 |
Sequenced Size: | 1004 |
Gene | Date | Evidence |
---|---|---|
CG5697 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5697 | 2002-04-26 | Blastp of sequenced clone |
CG5697 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5697 | 2008-04-29 | Release 5.5 accounting |
CG5697 | 2008-08-15 | Release 5.9 accounting |
CG5697 | 2008-12-18 | 5.12 accounting |
1004 bp (1004 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113581
> RH32180.complete GGCCAGTAGTCCGCCAGTTGCGAATGGAGCAATTTCCAGCCGGGAGTGTT TGCAATCCTGGTACTATCCCGTGAGAAGGGCTGAAAAAGGACTGTAAAAT ACCCAGTTCCCATCTATAGTTATCTGTCGTGCCTGCAAGGGGCTACGGCA ACTTTGGTGATAAAGTTACATAAACTGCGTATACCCTCTTGTTCGGCACA CATCCAGGGTACCACACGGCAAATATGTCCTGCAACGAGAAGACAGCGCT TCTGGCAACGCAACAAGGACATCAGCAGCGGCAGCAGCGGCAGCAGCAGC ACATCATTGTCGTGCCCGCGACGGGGAAGGATCCAAAGGATTATGAGCCC ATTTTCACAACTGCTGACTATTCCTACGGACTGACGCTCGAGGAGCTCCT GCCCTTCGCTCTGGATCCCTGGTGGCAGGCCGTACGGCGCCTCAGCTGCG GGCTCCTGGGCCTGACTTTCCTGCTGACCCTGATTGCTGGACTGGTTATG GCCTATTCCGACAGTGTCTGTCTCCCAAATAGAGCAATTAGCAGAAACGC GACCACCACGACAACGATGGCCACGCCACTATCCTTGGCTCTCAACGGCT CCCAGCTGCTGATGGCCAGTTTATAGTGGCCGTAAGCTAATCTGTGTAGC ATTTTGGAGATGCCGCAATCCACCCTGCGGAATTGCATCAGCCGCATCAG CTCGCACTATTAGCATTTGTTTGGCTTGCCGGTAATGGAGGCGACCTAAT CCTCCTCCTCTCTACTGTTTACCCCTACTCAAGCTGAGTGATAAGCGATG CACCGCGGGATTGATTGGTCGTGAAATAATTATACTGATTAACTTATTTG CTACACAACCGCCTACTCGTAAAGTAAAAAGAATGCAAAAGGTATAAGGA AGCGTTTCCGTACCAATTAAGAACATTGTATCGCAAACTTATTAATTTTT ATATATATACATATATATATATGAATATTACTTAAACCAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5697-RA | 1028 | CG5697-RA | 22..1014 | 2..994 | 4935 | 99.7 | Plus |
CG5697.c | 984 | CG5697.c | 2..984 | 2..987 | 4860 | 99.6 | Plus |
CG5697.a | 1012 | CG5697.a | 393..1012 | 368..987 | 3100 | 100 | Plus |
CG5697.a | 1012 | CG5697.a | 2..367 | 2..367 | 1830 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 16840360..16840979 | 368..987 | 3100 | 100 | Plus |
chr3R | 27901430 | chr3R | 16840078..16840286 | 159..367 | 1045 | 100 | Plus |
chr3R | 27901430 | chr3R | 16839809..16839966 | 2..159 | 790 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 21016501..21017127 | 368..994 | 3105 | 99.7 | Plus |
3R | 32079331 | 3R | 21016219..21016427 | 159..367 | 1045 | 100 | Plus |
3R | 32079331 | 3R | 21015950..21016107 | 2..159 | 790 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 20757332..20757958 | 368..994 | 3105 | 99.6 | Plus |
3R | 31820162 | 3R | 20757050..20757258 | 159..367 | 1045 | 100 | Plus |
3R | 31820162 | 3R | 20756781..20756938 | 2..159 | 790 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 16839808..16839966 | 1..159 | 99 | -> | Plus |
chr3R | 16840079..16840286 | 160..367 | 86 | -> | Plus |
chr3R | 16840360..16840936 | 368..944 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RA | 1..402 | 225..626 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RA | 1..402 | 225..626 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RB | 1..402 | 225..626 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RA | 1..402 | 225..626 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RB | 1..402 | 225..626 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RA | 2..987 | 2..987 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RA | 2..987 | 2..987 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RA | 2..987 | 2..987 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RA | 2..987 | 2..987 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5697-RA | 2..987 | 2..987 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21016220..21016427 | 160..367 | 100 | -> | Plus |
3R | 21015949..21016107 | 1..159 | 99 | -> | Plus |
3R | 21016501..21017120 | 368..988 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21016220..21016427 | 160..367 | 100 | -> | Plus |
3R | 21015949..21016107 | 1..159 | 99 | -> | Plus |
3R | 21016501..21017120 | 368..988 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21016220..21016427 | 160..367 | 100 | -> | Plus |
3R | 21015949..21016107 | 1..159 | 99 | -> | Plus |
3R | 21016501..21017120 | 368..988 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 16841671..16841829 | 1..159 | 99 | -> | Plus |
arm_3R | 16841942..16842149 | 160..367 | 100 | -> | Plus |
arm_3R | 16842223..16842842 | 368..988 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20757332..20757951 | 368..988 | 99 | Plus | |
3R | 20757051..20757258 | 160..367 | 100 | -> | Plus |
3R | 20756780..20756938 | 1..159 | 99 | -> | Plus |
Translation from 224 to 625
> RH32180.pep MSCNEKTALLATQQGHQQRQQRQQQHIIVVPATGKDPKDYEPIFTTADYS YGLTLEELLPFALDPWWQAVRRLSCGLLGLTFLLTLIAGLVMAYSDSVCL PNRAISRNATTTTTMATPLSLALNGSQLLMASL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18000-PA | 137 | GF18000-PA | 1..137 | 1..133 | 487 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24288-PA | 129 | GG24288-PA | 1..129 | 1..133 | 544 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21735-PA | 135 | GH21735-PA | 1..135 | 1..132 | 272 | 53.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5697-PD | 133 | CG5697-PD | 1..133 | 1..133 | 682 | 100 | Plus |
CG5697-PC | 133 | CG5697-PC | 1..133 | 1..133 | 682 | 100 | Plus |
CG5697-PB | 133 | CG5697-PB | 1..133 | 1..133 | 682 | 100 | Plus |
CG5697-PA | 133 | CG5697-PA | 1..133 | 1..133 | 682 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10757-PA | 132 | GI10757-PA | 1..94 | 1..94 | 266 | 62.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24292-PA | 922 | GL24292-PA | 816..922 | 42..133 | 263 | 51.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19065-PA | 140 | GA19065-PA | 1..140 | 1..133 | 429 | 60.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15057-PA | 128 | GM15057-PA | 1..128 | 1..133 | 443 | 88.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19390-PA | 129 | GD19390-PA | 1..129 | 1..133 | 621 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10699-PA | 127 | GJ10699-PA | 1..124 | 1..129 | 351 | 59.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11952-PA | 132 | GK11952-PA | 1..132 | 1..133 | 349 | 57.2 | Plus |
Translation from 224 to 625
> RH32180.hyp MSCNEKTALLATQQGHQQRQQRQQQHIIVVPATGKDPKDYEPIFTTADYS YGLTLEELLPFALDPWWQAVRRLSCGLLGLTFLLTLIAGLVMAYSDSVCL PNRAISRNATTTTTMATPLSLALNGSQLLMASL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5697-PD | 133 | CG5697-PD | 1..133 | 1..133 | 682 | 100 | Plus |
CG5697-PC | 133 | CG5697-PC | 1..133 | 1..133 | 682 | 100 | Plus |
CG5697-PB | 133 | CG5697-PB | 1..133 | 1..133 | 682 | 100 | Plus |
CG5697-PA | 133 | CG5697-PA | 1..133 | 1..133 | 682 | 100 | Plus |