Clone RH32613 Report

Search the DGRC for RH32613

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:326
Well:13
Vector:pFlc-1
Associated Gene/TranscriptCG15067-RA
Protein status:RH32613.pep: gold
Sequenced Size:727

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15067-RA 2009-01-21 est gleaning

Clone Sequence Records

RH32613.complete Sequence

727 bp assembled on 2009-04-09

GenBank Submission: BT082043.1

> RH32613.complete
TCTTTAGAGGGAATCATAATGAAGAGCCTGACGTTATTGGCGCTTTTGAT
CTTGGCCACGTTGGCCTTTGTCCACGGTGGCAAGGTGACCATCAACGGCA
AGTGCGTAAACTGCTCCCATGATCAAACGACTACCACCACGCACAAGCCA
ACAAGTGGAAAAGGAAGTGGAGGTAGGACGACAGCCCGGCCAAGCTCGAG
ATCATCTCCAGCCCGCGGTCGCCCATCATGGGATGACGATGATGATGATG
ACCTGACCGGTGACTGGGCACTGCATCAATCGGCTGGAGGAACTCAATAC
ATTGGCAGGCGTTCGAAGCGTCAGTCACGCGGTGGTCAGTACATCGATTT
GGGCGGATCTGGCGGAAGGGGTGGAGGCGGAGGATGGGCAGGATCTGGCA
TAACCACCATCGATTCCAGTGGCTATCCCGGCGGAACACTGGTGCGCAAT
AGTGATTGCGTCGGTTGCAATATTCGCGGATAAAGTCAATAAATTATTGA
AACACTAAGAAATTATCTTTTTTTTAAAACGAAGATTGTTTAAACTTATG
TGGTGGAGGAATCATCTGTAAACCAATATTCGAATTTTTTCTTATAGTCT
CTATAAATGATTGCGATTTAAATACAATTTACAATATAGCTTTCATTTTA
TTACATTTTTATTATGATGCTAAATATAAGTTTTGATTAAAAATTTCTAT
TTGCCACCACGAAAAAAAAAAAAAAAA

RH32613.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15067-RA 871 CG15067-RA 164..871 4..711 3540 100 Plus
CG15067-RB 762 CG15067-RB 164..762 4..602 2995 100 Plus
CG15067.a 457 CG15067.a 58..390 4..336 1665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14271871..14272498 711..76 2730 96.2 Minus
chr2R 21145070 chr2R 14272559..14272633 78..4 345 97.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18384822..18385459 713..76 3190 100 Minus
2R 25286936 2R 18385512..18385586 78..4 375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18386021..18386658 713..76 3190 100 Minus
2R 25260384 2R 18386711..18386785 78..4 375 100 Minus
Blast to na_te.dros performed 2019-03-16 15:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1062..1160 604..701 122 66 Plus

RH32613.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:03:23 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14271871..14272497 77..711 96 <- Minus
chr2R 14272561..14272634 1..76 94   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:24 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 1..465 19..483 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:59 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RB 1..465 19..483 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:40:15 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 1..465 19..483 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:50 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 1..465 19..483 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-10 11:30:05 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 3..623 4..624 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:59 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 3..622 4..623 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:40:15 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 2..711 1..711 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:50 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 2..711 1..711 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:03:23 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384824..18385458 77..711 100 <- Minus
2R 18385514..18385587 1..76 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:03:23 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384824..18385458 77..711 100 <- Minus
2R 18385514..18385587 1..76 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:03:23 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384824..18385458 77..711 100 <- Minus
2R 18385514..18385587 1..76 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:40:15 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14272329..14272963 77..711 100 <- Minus
arm_2R 14273019..14273092 1..76 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:20:12 Download gff for RH32613.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18386023..18386657 77..711 100 <- Minus
2R 18386713..18386786 1..76 97   Minus

RH32613.pep Sequence

Translation from 0 to 482

> RH32613.pep
SLEGIIMKSLTLLALLILATLAFVHGGKVTINGKCVNCSHDQTTTTTHKP
TSGKGSGGRTTARPSSRSSPARGRPSWDDDDDDDLTGDWALHQSAGGTQY
IGRRSKRQSRGGQYIDLGGSGGRGGGGGWAGSGITTIDSSGYPGGTLVRN
SDCVGCNIRG*

RH32613.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12768-PA 148 GF12768-PA 18..148 24..160 281 57.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20975-PA 157 GG20975-PA 1..157 7..160 443 87.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20221-PA 152 GH20221-PA 1..152 7..160 202 43.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG15067-PB 154 CG15067-PB 1..154 7..160 831 100 Plus
CG15067-PA 154 CG15067-PA 1..154 7..160 831 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19390-PA 146 GI19390-PA 21..146 26..160 138 42.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16706-PA 145 GL16706-PA 1..145 7..160 291 61.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13468-PA 145 GA13468-PA 1..145 7..160 286 60 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19910-PA 155 GM19910-PA 1..155 7..160 436 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25396-PA 155 GD25396-PA 1..155 7..160 748 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22453-PA 147 GJ22453-PA 1..147 7..160 279 48.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23236-PA 160 GK23236-PA 1..160 10..160 230 47 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13916-PA 154 GE13916-PA 1..154 7..160 404 81.3 Plus

RH32613.hyp Sequence

Translation from 3 to 482

> RH32613.hyp
LEGIIMKSLTLLALLILATLAFVHGGKVTINGKCVNCSHDQTTTTTHKPT
SGKGSGGRTTARPSSRSSPARGRPSWDDDDDDDLTGDWALHQSAGGTQYI
GRRSKRQSRGGQYIDLGGSGGRGGGGGWAGSGITTIDSSGYPGGTLVRNS
DCVGCNIRG*

RH32613.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG15067-PB 154 CG15067-PB 1..154 6..159 831 100 Plus
CG15067-PA 154 CG15067-PA 1..154 6..159 831 100 Plus