Clone RH32892 Report

Search the DGRC for RH32892

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:328
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCG1674-RD
Protein status:RH32892.pep: gold
Preliminary Size:2388
Sequenced Size:1477

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1674 2002-10-18 Blastp of sequenced clone
CG1674 2003-01-01 Sim4 clustering to Release 3
CG1674 2008-04-29 Release 5.5 accounting
CG1674 2008-08-15 Release 5.9 accounting
CG1674 2008-12-18 5.12 accounting

Clone Sequence Records

RH32892.complete Sequence

1477 bp (1477 high quality bases) assembled on 2002-10-18

GenBank Submission: BT001809

> RH32892.complete
GAGTGGAAGCTATCTTTGATGTGCAATCATATTCTTAAAGGCAGGCGCAT
GAATTCATGTTCATTCTATTGGCCTATACGGATTTTAGTTGTATTATTAT
CTTTCAATAATTCGATACTACAGTATTGTTTGCAGTAAATATTTTTTTAA
ACAAATAACATTGGGAAATAGGCAAGTGAAAAGATATATTTGATATATAT
TTGTACAGCTTTTAGATATGGATTCTACTTTAAATATTGAGAATGTCAAT
GACCCAACATCCATTGCATCTGATTTATCGGCCGAAAACACTAAAGCAGA
CCTTGTTTCGCTAAATGAACCGAATGTCAATGACCAAACATCCAGTGCAT
CTGATTTGACGGCCGAAAACACTAAAGCAGACCATGATTCGCTAAATAAA
CCTAAGGATTTTAATAACCAAATTCTGAACATTATATCGGATATAGATAT
AAATATAAAAGCACAGGAAAAAATAACACAGCTTAAAGAACAAGAACTAA
AACTCATTCAGAAACAGAATGATCTGGCAAATGAAATCCATAAGCAGCAG
ATCCTAGCTAAGCAGCTTAGTGCACAAAATCAGCTTAAACAAAATGAATG
TCAAAGTGGAGAGCTCGACTTACACAGTCAATATCAAAATGAGCGCGGCG
GACCCACCTCGACACTGTATCAGGAAAAAAATATAGCCAGTAAAGAATCC
GCTAATGTGTCGAAGACGGTTGATTTGCGAAAAATATTTACACCTGCGAC
CGATGCTGCTGAAATATTACCGAAAAACCGAAAGCTATATGCCTCGTCTG
CATTTTATTCTCCAACACTACACCCTACAGTGGAAGACCAAGTCGAGCTA
GCTCGAAGAATTTCACATTCATTAAGCGATATAAGTAATCAAACCTCTAA
GGGTCAGTCTATGTATGTCAATCGCAAAAAACGCTCAGACAAATGGGTTC
ATGAAGGTGGATCTCAAGGTAATGTTTTTTTTCAATATTTTTTGTTGTCA
GTCAGTTATTAATCAATTCTAGTTCCTACAATTGTATTATTATAACACTG
ATTGCAACTTTTAGTACAGTGGTCAAGAAAAATCTCATTAGTCTAACTCT
CCACTATAACAGGGATACCACGTTTCCCATTGTATGTGATTTTTGTTAAA
AATTTAAGTTTCTTGAATAGATTTTTATAATAAAACGATTATTTTTAACT
TGGTTTAACATAAACAATTCAACTGTTTATACGTTAAATAAAATTAATGT
ATTAGTATGTTCCCCAGTAATAAACACGTACAGTGCAGTCTTGATAGTTT
TCCGGTGCGACACTAATTTTCTGTTGTAATGTAATGAACTAAAAAATATA
ACATGTAGGAAATATTTTAAAAATATTGAAAAAAATACAAGTGACGATTG
CACCTTCAACACATGTACAAAAGATCTAATACTAATAAATTTTTATGACG
AAGAAAAAAAGAAAAAAAAAAAAAAAA

RH32892.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG1674-RD 1453 CG1674-RD 3..1453 3..1453 7240 99.9 Plus
CG1674-RH 3045 CG1674-RH 834..1566 242..974 3650 99.8 Plus
CG1674.m 3204 CG1674.m 1043..1694 323..974 3245 99.8 Plus
CG1674-RH 3045 CG1674-RH 25..263 3..241 1195 100 Plus
CG1674.m 3204 CG1674.m 99..267 3..171 845 100 Plus
CG1674.m 3204 CG1674.m 881..1015 242..376 435 88.1 Plus
CG1674-RH 3045 CG1674-RH 914..994 241..321 300 91.3 Plus
CG1674.m 3204 CG1674.m 1043..1122 242..321 295 91.2 Plus
CG1674.m 3204 CG1674.m 881..960 323..402 295 91.2 Plus
CG1674.m 3204 CG1674.m 264..310 195..241 220 97.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 261221..261897 780..1455 3320 99.7 Plus
chr4 1351717 chr4 257849..258140 404..695 1460 100 Plus
chr4 1351717 chr4 252025..252220 3..198 980 100 Plus
chr4 1351717 chr4 260890..260986 695..791 440 96.9 Plus
chr4 1351717 chr4 254844..254926 240..322 415 100 Plus
chr4 1351717 chr4 256974..257055 322..403 410 100 Plus
chr4 1351717 chr4 256973..257054 240..321 305 91.5 Plus
chr4 1351717 chr4 254845..254925 322..402 300 91.4 Plus
chr4 1351717 chr4 252523..252570 194..241 225 97.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 240645..241320 780..1455 3365 99.9 Plus
4 1348131 4 237269..237560 404..695 1460 100 Plus
4 1348131 4 231432..231627 3..198 980 100 Plus
4 1348131 4 240314..240410 695..791 440 96.9 Plus
4 1348131 4 234263..234345 240..322 415 100 Plus
4 1348131 4 236394..236475 322..403 410 100 Plus
4 1348131 4 236393..236474 240..321 305 91.5 Plus
4 1348131 4 234264..234344 322..402 300 91.4 Plus
4 1348131 4 231930..231977 194..241 225 97.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 240645..241320 780..1455 3365 99.8 Plus
4 1331231 4 237269..237560 404..695 1460 100 Plus
4 1331231 4 231432..231627 3..198 980 100 Plus
4 1331231 4 240314..240410 695..791 440 96.9 Plus
4 1331231 4 234263..234345 240..322 415 100 Plus
4 1331231 4 236394..236475 322..403 410 100 Plus
4 1331231 4 236393..236474 240..321 305 91.4 Plus
4 1331231 4 234264..234344 322..402 300 91.3 Plus
4 1331231 4 231930..231977 194..241 225 97.9 Plus
Blast to na_te.dros performed 2019-03-16 19:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3780..4108 1135..1456 141 52.7 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 7018..7119 1230..1132 133 61.8 Minus
micropia 5461 micropia DMDM11 5461bp 3249..3308 675..733 117 68.3 Plus
412 7567 412 412 7567bp 1779..1832 1332..1385 117 68.5 Plus
Tirant 8526 Tirant TIRANT 8526bp 577..646 447..516 116 62.9 Plus
Tc1 1666 Tc1 TC1 1666bp 1410..1563 1460..1310 114 54.5 Minus
Tirant 8526 Tirant TIRANT 8526bp 4018..4150 403..544 113 58 Plus

RH32892.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:58:11 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 252023..252220 1..198 99 -> Plus
chr4 252528..252570 199..241 100 -> Plus
chr4 254846..254926 242..322 100 -> Plus
chr4 256975..257055 323..403 100 -> Plus
chr4 257849..258139 404..694 100 -> Plus
chr4 260890..260974 695..779 100 -> Plus
chr4 261221..261897 780..1455 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:44:59 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 1..795 218..1012 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:09:52 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 1..795 218..1012 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:58 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 1..795 218..1012 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:00:46 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 1..795 218..1012 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:46:52 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 1..795 218..1012 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:30:56 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 1..1459 1..1459 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:09:52 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 1..1453 1..1453 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:58 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 5..1457 1..1453 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:00:46 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 1..1459 1..1459 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:46:52 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 5..1457 1..1453 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:11 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
4 231430..231627 1..198 99 -> Plus
4 231935..231977 199..241 100 -> Plus
4 234265..234345 242..322 100 -> Plus
4 236395..236475 323..403 100 -> Plus
4 237269..237559 404..694 100 -> Plus
4 240314..240398 695..779 100 -> Plus
4 240645..241320 780..1455 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:11 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
4 231430..231627 1..198 99 -> Plus
4 231935..231977 199..241 100 -> Plus
4 234265..234345 242..322 100 -> Plus
4 236395..236475 323..403 100 -> Plus
4 237269..237559 404..694 100 -> Plus
4 240314..240398 695..779 100 -> Plus
4 240645..241320 780..1455 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:11 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
4 231430..231627 1..198 99 -> Plus
4 231935..231977 199..241 100 -> Plus
4 234265..234345 242..322 100 -> Plus
4 236395..236475 323..403 100 -> Plus
4 237269..237559 404..694 100 -> Plus
4 240314..240398 695..779 100 -> Plus
4 240645..241320 780..1455 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:58 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 252056..252253 1..198 99 -> Plus
arm_4 252561..252603 199..241 100 -> Plus
arm_4 254891..254971 242..322 100 -> Plus
arm_4 257021..257101 323..403 100 -> Plus
arm_4 257895..258185 404..694 100 -> Plus
arm_4 260940..261024 695..779 100 -> Plus
arm_4 261271..261946 780..1455 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:32:19 Download gff for RH32892.complete
Subject Subject Range Query Range Percent Splice Strand
4 237269..237559 404..694 100 -> Plus
4 240314..240398 695..779 100 -> Plus
4 240645..241320 780..1455 99   Plus
4 231430..231627 1..198 99 -> Plus
4 231935..231977 199..241 100 -> Plus
4 234265..234345 242..322 100 -> Plus
4 236395..236475 323..403 100 -> Plus

RH32892.pep Sequence

Translation from 217 to 1011

> RH32892.pep
MDSTLNIENVNDPTSIASDLSAENTKADLVSLNEPNVNDQTSSASDLTAE
NTKADHDSLNKPKDFNNQILNIISDIDINIKAQEKITQLKEQELKLIQKQ
NDLANEIHKQQILAKQLSAQNQLKQNECQSGELDLHSQYQNERGGPTSTL
YQEKNIASKESANVSKTVDLRKIFTPATDAAEILPKNRKLYASSAFYSPT
LHPTVEDQVELARRISHSLSDISNQTSKGQSMYVNRKKRSDKWVHEGGSQ
GNVFFQYFLLSVSY*

RH32892.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21685-PA 93 GF21685-PA 4..93 163..252 450 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16382-PA 884 GG16382-PA 206..458 12..252 903 79.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23958-PA 897 GH23958-PA 258..462 63..251 510 67.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG1674-PD 264 CG1674-PD 1..264 1..264 1332 100 Plus
CG1674-PJ 694 CG1674-PJ 1..252 1..252 1271 100 Plus
CG1674-PI 589 CG1674-PI 1..255 1..257 1260 98.4 Plus
CG1674-PK 860 CG1674-PK 1..279 1..252 1233 90.3 Plus
CG1674-PH 884 CG1674-PH 198..442 8..252 1233 99.6 Plus
CG1674-PF 884 CG1674-PF 198..442 8..252 1233 99.6 Plus
CG1674-PE 884 CG1674-PE 198..442 8..252 1233 99.6 Plus
CG1674-PM 843 CG1674-PM 198..442 8..252 1225 99.2 Plus
CG1674-PL 905 CG1674-PL 1..324 1..252 1177 77.8 Plus
CG1674-PB 743 CG1674-PB 198..425 8..207 869 80.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14038-PA 878 GI14038-PA 215..439 45..251 551 62.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18162-PA 650 GL18162-PA 1..194 63..252 584 73.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14119-PA 637 GA14119-PA 9..202 63..252 583 73.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26789-PA 778 GM26789-PA 198..444 8..257 1088 91.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24401-PA 808 GD24401-PA 32..270 5..207 710 70.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12646-PA 901 GJ12646-PA 234..463 63..250 530 59.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13676-PA 1050 GK13676-PA 214..423 15..250 600 60.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14542-PA 886 GE14542-PA 216..462 4..252 920 80.3 Plus

RH32892.hyp Sequence

Translation from 217 to 1011

> RH32892.hyp
MDSTLNIENVNDPTSIASDLSAENTKADLVSLNEPNVNDQTSSASDLTAE
NTKADHDSLNKPKDFNNQILNIISDIDINIKAQEKITQLKEQELKLIQKQ
NDLANEIHKQQILAKQLSAQNQLKQNECQSGELDLHSQYQNERGGPTSTL
YQEKNIASKESANVSKTVDLRKIFTPATDAAEILPKNRKLYASSAFYSPT
LHPTVEDQVELARRISHSLSDISNQTSKGQSMYVNRKKRSDKWVHEGGSQ
GNVFFQYFLLSVSY*

RH32892.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG1674-PD 264 CG1674-PD 1..264 1..264 1332 100 Plus
CG1674-PJ 694 CG1674-PJ 1..252 1..252 1271 100 Plus
CG1674-PI 589 CG1674-PI 1..255 1..257 1260 98.4 Plus
CG1674-PK 860 CG1674-PK 1..279 1..252 1233 90.3 Plus
CG1674-PH 884 CG1674-PH 198..442 8..252 1233 99.6 Plus