Clone RH33060 Report

Search the DGRC for RH33060

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:330
Well:60
Vector:pFlc-1
Associated Gene/TranscriptCG11413-RA
Protein status:RH33060.pep: gold
Preliminary Size:611
Sequenced Size:622

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11413 2002-01-01 Sim4 clustering to Release 2
CG11413 2002-01-09 Blastp of sequenced clone
CG11413 2003-01-01 Sim4 clustering to Release 3
CG11413 2008-04-29 Release 5.5 accounting
CG11413 2008-08-15 Release 5.9 accounting
CG11413 2008-12-18 5.12 accounting

Clone Sequence Records

RH33060.complete Sequence

622 bp (622 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075540

> RH33060.complete
GACACTCACCATGGATCTTCTCAAGAGGCACCTGCTGCTCCTGGTCATCG
GAGCTTGCCTGTGTGTCTGCGCCCAGGCCACGATCACCATCCAGAAAACC
AAGCCAGCGCTGCCGGATCCCAGCCAGTTGCTAGCCAAGCTACCGCCAAA
GCCGGACTTTCTCAAGGATCCCTCTAAATTACTAGCCAAAATCGCGCAAT
CCAAACCAGCTCTCCCAGATCCCAGCCAGCTGCTCGCCAAACTGCCGCCC
AAGCCCGCTATCCTCAAGGATCCCAGCCAGCTGCTCTCCAAGTTCGTGAA
ACCAAAGCCAGTGATCATAAAGCCGGTGATTGTGAAGCCGGTGGTGGTGG
TCAAGCCCGTGGCGGTTGGCGGAGGTGGCGGTGGTCACGGCCACGGACAT
CATGGACATCATGGACACCATGGCAAGGGCAAGCTATAACTTTAGATTTC
TTTATAGAGTAACAGTAAGAGAAAGAGAAAGGTGAAATATAATTTAAGTA
AATGTATACATCTGTGACAAGTTCATCACTCGGCTTTAAAAACAATCTAT
AAACCACTTCAGTGTAAAATGCTTATACTTAATAAAAGCGTGTAAGTAAA
GAGTAAGAAAAAAAAAAAAAAA

RH33060.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG11413-RA 604 CG11413-RA 3..604 2..603 3010 100 Plus
CG4622-RC 2698 CG4622-RC 291..742 453..2 2260 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20422105..20422708 2..605 3020 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24536190..24536793 2..605 3020 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24537389..24537992 2..605 3020 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:54:22 has no hits.

RH33060.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:55:34 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20422103..20422708 1..607 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:00 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:49:15 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:11 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:36 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:38:16 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:53 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..608 1..607 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:49:15 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..602 2..603 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:11 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..602 2..603 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:36 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..608 1..607 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:38:16 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
CG11413-RA 1..602 2..603 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:34 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24536188..24536795 1..607 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:34 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24536188..24536795 1..607 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:34 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24536188..24536795 1..607 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:11 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20423711..20424318 1..607 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:11:01 Download gff for RH33060.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24537405..24538012 1..607 99   Plus

RH33060.hyp Sequence

Translation from 0 to 438

> RH33060.hyp
TLTMDLLKRHLLLLVIGACLCVCAQATITIQKTKPALPDPSQLLAKLPPK
PDFLKDPSKLLAKIAQSKPALPDPSQLLAKLPPKPAILKDPSQLLSKFVK
PKPVIIKPVIVKPVVVVKPVAVGGGGGGHGHGHHGHHGHHGKGKL*

RH33060.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11413-PA 142 CG11413-PA 1..142 4..145 749 100 Plus

RH33060.pep Sequence

Translation from 10 to 438

> RH33060.pep
MDLLKRHLLLLVIGACLCVCAQATITIQKTKPALPDPSQLLAKLPPKPDF
LKDPSKLLAKIAQSKPALPDPSQLLAKLPPKPAILKDPSQLLSKFVKPKP
VIIKPVIVKPVVVVKPVAVGGGGGGHGHGHHGHHGHHGKGKL*

RH33060.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22977-PA 151 GG22977-PA 22..108 22..104 350 89.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11413-PA 142 CG11413-PA 1..142 1..142 749 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10218-PA 124 GL10218-PA 1..83 1..102 136 40.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11872-PA 146 GM11872-PA 1..95 1..95 429 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11870-PA 146 GD11870-PA 1..95 1..95 372 95.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14415-PA 146 GE14415-PA 20..106 20..102 349 89.7 Plus