RH33060.complete Sequence
622 bp (622 high quality bases) assembled on 2002-01-09
GenBank Submission: AY075540
> RH33060.complete
GACACTCACCATGGATCTTCTCAAGAGGCACCTGCTGCTCCTGGTCATCG
GAGCTTGCCTGTGTGTCTGCGCCCAGGCCACGATCACCATCCAGAAAACC
AAGCCAGCGCTGCCGGATCCCAGCCAGTTGCTAGCCAAGCTACCGCCAAA
GCCGGACTTTCTCAAGGATCCCTCTAAATTACTAGCCAAAATCGCGCAAT
CCAAACCAGCTCTCCCAGATCCCAGCCAGCTGCTCGCCAAACTGCCGCCC
AAGCCCGCTATCCTCAAGGATCCCAGCCAGCTGCTCTCCAAGTTCGTGAA
ACCAAAGCCAGTGATCATAAAGCCGGTGATTGTGAAGCCGGTGGTGGTGG
TCAAGCCCGTGGCGGTTGGCGGAGGTGGCGGTGGTCACGGCCACGGACAT
CATGGACATCATGGACACCATGGCAAGGGCAAGCTATAACTTTAGATTTC
TTTATAGAGTAACAGTAAGAGAAAGAGAAAGGTGAAATATAATTTAAGTA
AATGTATACATCTGTGACAAGTTCATCACTCGGCTTTAAAAACAATCTAT
AAACCACTTCAGTGTAAAATGCTTATACTTAATAAAAGCGTGTAAGTAAA
GAGTAAGAAAAAAAAAAAAAAA
RH33060.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:19:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11413-RA | 604 | CG11413-RA | 3..604 | 2..603 | 3010 | 100 | Plus |
CG4622-RC | 2698 | CG4622-RC | 291..742 | 453..2 | 2260 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:54:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 20422105..20422708 | 2..605 | 3020 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:54:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24536190..24536793 | 2..605 | 3020 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 24537389..24537992 | 2..605 | 3020 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 22:54:22 has no hits.
RH33060.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:55:34 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 20422103..20422708 | 1..607 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:00 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..429 | 11..439 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:49:15 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..429 | 11..439 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:11 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..429 | 11..439 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:36 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..429 | 11..439 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:38:16 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..429 | 11..439 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:53 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..608 | 1..607 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:49:15 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..602 | 2..603 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:11 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..602 | 2..603 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:36 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..608 | 1..607 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:38:16 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11413-RA | 1..602 | 2..603 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:34 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24536188..24536795 | 1..607 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:34 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24536188..24536795 | 1..607 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:34 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24536188..24536795 | 1..607 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:11 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 20423711..20424318 | 1..607 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:11:01 Download gff for
RH33060.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24537405..24538012 | 1..607 | 99 | | Plus |
RH33060.hyp Sequence
Translation from 0 to 438
> RH33060.hyp
TLTMDLLKRHLLLLVIGACLCVCAQATITIQKTKPALPDPSQLLAKLPPK
PDFLKDPSKLLAKIAQSKPALPDPSQLLAKLPPKPAILKDPSQLLSKFVK
PKPVIIKPVIVKPVVVVKPVAVGGGGGGHGHGHHGHHGHHGKGKL*
RH33060.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11413-PA | 142 | CG11413-PA | 1..142 | 4..145 | 749 | 100 | Plus |
RH33060.pep Sequence
Translation from 10 to 438
> RH33060.pep
MDLLKRHLLLLVIGACLCVCAQATITIQKTKPALPDPSQLLAKLPPKPDF
LKDPSKLLAKIAQSKPALPDPSQLLAKLPPKPAILKDPSQLLSKFVKPKP
VIIKPVIVKPVVVVKPVAVGGGGGGHGHGHHGHHGHHGKGKL*
RH33060.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:34:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22977-PA | 151 | GG22977-PA | 22..108 | 22..104 | 350 | 89.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11413-PA | 142 | CG11413-PA | 1..142 | 1..142 | 749 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:34:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10218-PA | 124 | GL10218-PA | 1..83 | 1..102 | 136 | 40.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:34:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM11872-PA | 146 | GM11872-PA | 1..95 | 1..95 | 429 | 95.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:34:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11870-PA | 146 | GD11870-PA | 1..95 | 1..95 | 372 | 95.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:34:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14415-PA | 146 | GE14415-PA | 20..106 | 20..102 | 349 | 89.7 | Plus |