Clone RH33338 Report

Search the DGRC for RH33338

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:333
Well:38
Vector:pFlc-1
Associated Gene/TranscriptCG14141-RA
Protein status:RH33338.pep: gold
Preliminary Size:444
Sequenced Size:815

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14141 2002-01-01 Sim4 clustering to Release 2
CG14141 2002-03-28 Blastp of sequenced clone
CG14141 2003-01-01 Sim4 clustering to Release 3
CG14141 2008-04-29 Release 5.5 accounting
CG14141 2008-08-15 Release 5.9 accounting
CG14141 2008-12-18 5.12 accounting

Clone Sequence Records

RH33338.complete Sequence

815 bp (815 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094920

> RH33338.complete
GATATGAGCCGAGCAGAGTGGTGCAGACTCTGGCCGAGTGGATCAGTCAC
CGATCAAACGAGATTCGCACAGCAACGCCAGCAGCAGCAGCAGCAGCAGG
AAAATATAGCGACAGTGATCATCTCCGTCAGCAGCATTATCCATTATCCG
GAGAGTCATGCAGGTTAAGTGCCTGATCGTCTGTCTCGCTTTGGGGCTAT
TAATGCTGGCCACGCCCGTTTGCGAAGCGCGCCGAGGGCGTGGACGTGGA
CGAACCAAGTCCAGGGTGCAGATCGGATTGCCAATTACCGGAAAATATCG
CGATCCGGAGTCCGATCAGTACTACAATAATAATAATGGCGCCAAAATCC
TACAAGCCTCGCACTTCGATCTTGAGTACGTTCTGGGCCACAAGATCGCC
TTTTTGTGCGTGGCCAAGGGCAATCCCCGACCCCATATCACCTGGTACAA
GGACGGAGCGGAGATCTATCAGCACCTCTATATGCACGTACACGAATGGC
GCATCGGCGACGACAAGGTCAAGTCGAAGATCGAAATTGACCCTGCCACA
CAGATGGACGCTGGACTCTACGAATGCACCGCCGACAACATGTACTCCAT
CGATCGGCGCAGTTTTAAGACGGATTTCTCCATTGCCTTCGACTGATCGC
AACAAAGCCATTATCATTCTTATTATTTCAAATTTGTTGCACTTGGCAAA
ACATAAAAAATAAATCTGAAATATATCAGAGTACATGACAAAAAAGAATC
TTTTATGAAGAAAATCTCGTTTAAAAAATGGAATAAAATAGTGTATACTC
AAAAAAAAAAAAAAA

RH33338.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14141-RA 1179 CG14141-RA 380..1179 4..803 3985 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11192542..11193002 338..798 2305 100 Plus
chr3L 24539361 chr3L 11192155..11192489 4..338 1675 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11201696..11202161 338..803 2315 99.8 Plus
3L 28110227 3L 11201309..11201643 4..338 1675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11194796..11195261 338..803 2315 99.7 Plus
3L 28103327 3L 11194409..11194743 4..338 1675 100 Plus
Blast to na_te.dros performed 2019-03-16 13:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 549..621 684..757 133 66.2 Plus
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 750..840 698..791 129 62.8 Plus

RH33338.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:07:33 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11192542..11193003 338..800 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:02 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..489 158..646 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:22:38 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..489 158..646 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:15:39 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..489 158..646 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:15 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..489 158..646 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:14:00 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..489 158..646 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:49:34 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..799 3..800 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:22:38 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..799 3..800 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:15:39 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..754 46..800 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:15 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..792 3..792 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:00 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
CG14141-RA 1..754 46..800 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:33 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11201306..11201642 1..337 99 -> Plus
3L 11201696..11202157 338..800 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:33 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11201306..11201642 1..337 99 -> Plus
3L 11201696..11202157 338..800 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:33 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11201306..11201642 1..337 99 -> Plus
3L 11201696..11202157 338..800 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:15:39 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11194406..11194742 1..337 99 -> Plus
arm_3L 11194796..11195257 338..800 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:32:03 Download gff for RH33338.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11194406..11194742 1..337 99 -> Plus
3L 11194796..11195257 338..800 99   Plus

RH33338.pep Sequence

Translation from 157 to 645

> RH33338.pep
MQVKCLIVCLALGLLMLATPVCEARRGRGRGRTKSRVQIGLPITGKYRDP
ESDQYYNNNNGAKILQASHFDLEYVLGHKIAFLCVAKGNPRPHITWYKDG
AEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYECTADNMYSIDR
RSFKTDFSIAFD*

RH33338.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25252-PA 162 GF25252-PA 1..162 1..162 869 97.5 Plus
Dana\GF25251-PA 172 GF25251-PA 30..167 20..157 376 49.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15489-PA 162 GG15489-PA 1..162 1..162 878 99.4 Plus
Dere\GG15488-PA 167 GG15488-PA 11..165 7..160 426 51 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14839-PA 164 GH14839-PA 1..164 1..162 746 92.1 Plus
Dgri\GH14838-PA 160 GH14838-PA 20..158 23..160 398 51.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14141-PA 162 CG14141-PA 1..162 1..162 873 100 Plus
CG7607-PA 167 CG7607-PA 11..162 7..157 417 52 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13691-PA 164 GI13691-PA 1..164 1..162 767 92.1 Plus
Dmoj\GI13690-PA 170 GI13690-PA 29..167 22..159 400 51.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22772-PA 163 GL22772-PA 21..163 20..162 718 97.9 Plus
Dper\GL22771-PA 195 GL22771-PA 67..190 21..157 317 44.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12785-PA 163 GA12785-PA 21..163 20..162 718 97.9 Plus
Dpse\GA20476-PA 208 GA20476-PA 67..203 21..157 403 52.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25261-PA 162 GM25261-PA 1..162 1..162 878 99.4 Plus
Dsec\GM25260-PA 167 GM25260-PA 11..165 7..160 426 51 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14295-PA 162 GD14295-PA 1..162 1..162 878 99.4 Plus
Dsim\GD14294-PA 167 GD14294-PA 11..165 7..160 426 51 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14034-PA 164 GJ14034-PA 18..164 16..162 723 95.9 Plus
Dvir\GJ14033-PA 173 GJ14033-PA 31..170 20..159 403 51.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20344-PA 162 GK20344-PA 1..162 1..162 863 96.9 Plus
Dwil\GK20343-PA 166 GK20343-PA 25..161 21..157 409 52.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21800-PA 162 GE21800-PA 1..162 1..162 878 99.4 Plus
Dyak\GE21799-PA 167 GE21799-PA 11..162 7..157 423 52 Plus

RH33338.hyp Sequence

Translation from 157 to 645

> RH33338.hyp
MQVKCLIVCLALGLLMLATPVCEARRGRGRGRTKSRVQIGLPITGKYRDP
ESDQYYNNNNGAKILQASHFDLEYVLGHKIAFLCVAKGNPRPHITWYKDG
AEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYECTADNMYSIDR
RSFKTDFSIAFD*

RH33338.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14141-PA 162 CG14141-PA 1..162 1..162 873 100 Plus
CG7607-PA 167 CG7607-PA 11..162 7..157 417 52 Plus