BDGP Sequence Production Resources |
Search the DGRC for RH33338
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 333 |
Well: | 38 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG14141-RA |
Protein status: | RH33338.pep: gold |
Preliminary Size: | 444 |
Sequenced Size: | 815 |
Gene | Date | Evidence |
---|---|---|
CG14141 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14141 | 2002-03-28 | Blastp of sequenced clone |
CG14141 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14141 | 2008-04-29 | Release 5.5 accounting |
CG14141 | 2008-08-15 | Release 5.9 accounting |
CG14141 | 2008-12-18 | 5.12 accounting |
815 bp (815 high quality bases) assembled on 2002-03-28
GenBank Submission: AY094920
> RH33338.complete GATATGAGCCGAGCAGAGTGGTGCAGACTCTGGCCGAGTGGATCAGTCAC CGATCAAACGAGATTCGCACAGCAACGCCAGCAGCAGCAGCAGCAGCAGG AAAATATAGCGACAGTGATCATCTCCGTCAGCAGCATTATCCATTATCCG GAGAGTCATGCAGGTTAAGTGCCTGATCGTCTGTCTCGCTTTGGGGCTAT TAATGCTGGCCACGCCCGTTTGCGAAGCGCGCCGAGGGCGTGGACGTGGA CGAACCAAGTCCAGGGTGCAGATCGGATTGCCAATTACCGGAAAATATCG CGATCCGGAGTCCGATCAGTACTACAATAATAATAATGGCGCCAAAATCC TACAAGCCTCGCACTTCGATCTTGAGTACGTTCTGGGCCACAAGATCGCC TTTTTGTGCGTGGCCAAGGGCAATCCCCGACCCCATATCACCTGGTACAA GGACGGAGCGGAGATCTATCAGCACCTCTATATGCACGTACACGAATGGC GCATCGGCGACGACAAGGTCAAGTCGAAGATCGAAATTGACCCTGCCACA CAGATGGACGCTGGACTCTACGAATGCACCGCCGACAACATGTACTCCAT CGATCGGCGCAGTTTTAAGACGGATTTCTCCATTGCCTTCGACTGATCGC AACAAAGCCATTATCATTCTTATTATTTCAAATTTGTTGCACTTGGCAAA ACATAAAAAATAAATCTGAAATATATCAGAGTACATGACAAAAAAGAATC TTTTATGAAGAAAATCTCGTTTAAAAAATGGAATAAAATAGTGTATACTC AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14141-RA | 1179 | CG14141-RA | 380..1179 | 4..803 | 3985 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
roo | 9092 | roo DM_ROO 9092bp | 549..621 | 684..757 | 133 | 66.2 | Plus |
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 750..840 | 698..791 | 129 | 62.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 11192542..11193003 | 338..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..489 | 158..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..489 | 158..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..489 | 158..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..489 | 158..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..489 | 158..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..799 | 3..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..799 | 3..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..754 | 46..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..792 | 3..792 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14141-RA | 1..754 | 46..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11201306..11201642 | 1..337 | 99 | -> | Plus |
3L | 11201696..11202157 | 338..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11201306..11201642 | 1..337 | 99 | -> | Plus |
3L | 11201696..11202157 | 338..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11201306..11201642 | 1..337 | 99 | -> | Plus |
3L | 11201696..11202157 | 338..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 11194406..11194742 | 1..337 | 99 | -> | Plus |
arm_3L | 11194796..11195257 | 338..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11194406..11194742 | 1..337 | 99 | -> | Plus |
3L | 11194796..11195257 | 338..800 | 99 | Plus |
Translation from 157 to 645
> RH33338.pep MQVKCLIVCLALGLLMLATPVCEARRGRGRGRTKSRVQIGLPITGKYRDP ESDQYYNNNNGAKILQASHFDLEYVLGHKIAFLCVAKGNPRPHITWYKDG AEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYECTADNMYSIDR RSFKTDFSIAFD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25252-PA | 162 | GF25252-PA | 1..162 | 1..162 | 869 | 97.5 | Plus |
Dana\GF25251-PA | 172 | GF25251-PA | 30..167 | 20..157 | 376 | 49.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15489-PA | 162 | GG15489-PA | 1..162 | 1..162 | 878 | 99.4 | Plus |
Dere\GG15488-PA | 167 | GG15488-PA | 11..165 | 7..160 | 426 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14839-PA | 164 | GH14839-PA | 1..164 | 1..162 | 746 | 92.1 | Plus |
Dgri\GH14838-PA | 160 | GH14838-PA | 20..158 | 23..160 | 398 | 51.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14141-PA | 162 | CG14141-PA | 1..162 | 1..162 | 873 | 100 | Plus |
CG7607-PA | 167 | CG7607-PA | 11..162 | 7..157 | 417 | 52 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13691-PA | 164 | GI13691-PA | 1..164 | 1..162 | 767 | 92.1 | Plus |
Dmoj\GI13690-PA | 170 | GI13690-PA | 29..167 | 22..159 | 400 | 51.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22772-PA | 163 | GL22772-PA | 21..163 | 20..162 | 718 | 97.9 | Plus |
Dper\GL22771-PA | 195 | GL22771-PA | 67..190 | 21..157 | 317 | 44.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12785-PA | 163 | GA12785-PA | 21..163 | 20..162 | 718 | 97.9 | Plus |
Dpse\GA20476-PA | 208 | GA20476-PA | 67..203 | 21..157 | 403 | 52.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25261-PA | 162 | GM25261-PA | 1..162 | 1..162 | 878 | 99.4 | Plus |
Dsec\GM25260-PA | 167 | GM25260-PA | 11..165 | 7..160 | 426 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14295-PA | 162 | GD14295-PA | 1..162 | 1..162 | 878 | 99.4 | Plus |
Dsim\GD14294-PA | 167 | GD14294-PA | 11..165 | 7..160 | 426 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14034-PA | 164 | GJ14034-PA | 18..164 | 16..162 | 723 | 95.9 | Plus |
Dvir\GJ14033-PA | 173 | GJ14033-PA | 31..170 | 20..159 | 403 | 51.4 | Plus |
Translation from 157 to 645
> RH33338.hyp MQVKCLIVCLALGLLMLATPVCEARRGRGRGRTKSRVQIGLPITGKYRDP ESDQYYNNNNGAKILQASHFDLEYVLGHKIAFLCVAKGNPRPHITWYKDG AEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYECTADNMYSIDR RSFKTDFSIAFD*