BDGP Sequence Production Resources |
Search the DGRC for RH33561
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 335 |
Well: | 61 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CecC-RA |
Protein status: | RH33561.pep: gold |
Preliminary Size: | 192 |
Sequenced Size: | 403 |
Gene | Date | Evidence |
---|---|---|
CG1373 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1373 | 2002-04-26 | Blastp of sequenced clone |
CG1373 | 2003-01-01 | Sim4 clustering to Release 3 |
CecC | 2008-04-29 | Release 5.5 accounting |
CecC | 2008-08-15 | Release 5.9 accounting |
CecC | 2008-12-18 | 5.12 accounting |
403 bp (403 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113583
> RH33561.complete GATCAGTCGCTCAGTTTCCACAGCAGCTAAACAGCTAAATCGCAATCTAT ATATATATATATATACTAAGGAATTAAACCTAGAAAATTCACCATGAACT TCTACAAGATCTTCGTTTTCGTCGCCCTCATCCTGGCCATCAGCATTGGA CAATCGGAAGCCGGTTGGCTGAAGAAACTTGGCAAGAGAATCGAGCGCAT TGGCCAGCACACCCGGGATGCAACCATTCAAGGACTGGGAATTGCGCAAC AGGCCGCCAATGTGGCAGCCACCGCCAGAGGATGAGCCTTTAATGTCCAT CAAAGGACTCTACCAGGATAACGCGCGTTTAATTATACACACTTATTTAT TTACCAGCCATAGAAATAAACTAGCTTACATCCCCGCAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 26039213..26039406 | 193..386 | 940 | 99 | Plus |
chr3R | 27901430 | chr3R | 26038953..26039144 | 2..193 | 930 | 99 | Plus |
chr3R | 27901430 | chr3R | 26034699..26034802 | 90..193 | 400 | 92.3 | Plus |
chr3R | 27901430 | chr3R | 26033408..26033512 | 89..193 | 390 | 91.4 | Plus |
chr3R | 27901430 | chr3R | 26036096..26036196 | 193..93 | 265 | 84.2 | Minus |
chr3R | 27901430 | chr3R | 26034867..26034939 | 200..272 | 215 | 86.3 | Plus |
chr3R | 27901430 | chr3R | 26033576..26033665 | 196..285 | 210 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 30216745..30216938 | 193..386 | 970 | 100 | Plus |
3R | 32079331 | 3R | 30216485..30216676 | 2..193 | 960 | 100 | Plus |
3R | 32079331 | 3R | 30210943..30211047 | 89..193 | 405 | 92.4 | Plus |
3R | 32079331 | 3R | 30212234..30212337 | 90..193 | 400 | 92.3 | Plus |
3R | 32079331 | 3R | 30213626..30213726 | 193..93 | 220 | 81.2 | Minus |
3R | 32079331 | 3R | 30211111..30211200 | 196..285 | 210 | 82.2 | Plus |
3R | 32079331 | 3R | 30212402..30212474 | 200..272 | 200 | 84.9 | Plus |
3R | 32079331 | 3R | 30213476..30213565 | 285..196 | 195 | 81.1 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29957576..29957769 | 193..386 | 970 | 100 | Plus |
3R | 31820162 | 3R | 29957316..29957507 | 2..193 | 960 | 100 | Plus |
3R | 31820162 | 3R | 29951774..29951878 | 89..193 | 405 | 92.3 | Plus |
3R | 31820162 | 3R | 29953065..29953168 | 90..193 | 400 | 92.3 | Plus |
3R | 31820162 | 3R | 29954457..29954557 | 193..93 | 220 | 81.1 | Minus |
3R | 31820162 | 3R | 29951942..29952031 | 196..285 | 210 | 82.2 | Plus |
3R | 31820162 | 3R | 29953233..29953305 | 200..272 | 200 | 84.9 | Plus |
3R | 31820162 | 3R | 29954307..29954396 | 285..196 | 195 | 81.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 26038952..26039143 | 1..192 | 98 | -> | Plus |
chr3R | 26039213..26039406 | 193..387 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 1..192 | 94..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 1..192 | 94..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 1..192 | 94..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 1..192 | 94..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 1..192 | 94..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 2..385 | 2..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 2..385 | 2..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 2..386 | 2..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 2..385 | 2..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CecC-RA | 2..386 | 2..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30216484..30216675 | 1..192 | 99 | -> | Plus |
3R | 30216745..30216938 | 193..387 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30216484..30216675 | 1..192 | 99 | -> | Plus |
3R | 30216745..30216938 | 193..387 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30216484..30216675 | 1..192 | 99 | -> | Plus |
3R | 30216745..30216938 | 193..387 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 26042206..26042397 | 1..192 | 99 | -> | Plus |
arm_3R | 26042467..26042660 | 193..387 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29957315..29957506 | 1..192 | 99 | -> | Plus |
3R | 29957576..29957769 | 193..387 | 99 | Plus |
Translation from 93 to 284
> RH33561.hyp MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGI AQQAANVAATARG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CecC-PA | 63 | CG1373-PA | 1..63 | 1..63 | 311 | 100 | Plus |
CecA2-PA | 63 | CG1367-PA | 1..63 | 1..63 | 297 | 92.1 | Plus |
CecA1-PA | 63 | CG1365-PA | 1..63 | 1..63 | 297 | 92.1 | Plus |
CecB-PA | 63 | CG1878-PA | 1..63 | 1..63 | 276 | 88.9 | Plus |
Translation from 93 to 284
> RH33561.pep MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGI AQQAANVAATARG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18827-PA | 63 | GF18827-PA | 1..63 | 1..63 | 301 | 90.5 | Plus |
Dana\GF18829-PA | 63 | GF18829-PA | 1..63 | 1..63 | 276 | 85.7 | Plus |
Dana\GF16190-PA | 63 | GF16190-PA | 1..63 | 1..63 | 232 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11739-PA | 63 | GG11739-PA | 1..63 | 1..63 | 302 | 92.1 | Plus |
Dere\GG26130-PA | 63 | GG11740-PA | 1..63 | 1..63 | 302 | 92.1 | Plus |
Dere\GG11950-PA | 63 | GG11950-PA | 1..63 | 1..63 | 285 | 90.5 | Plus |
Dere\GG11742-PA | 66 | GG11742-PA | 1..63 | 1..63 | 154 | 46 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23329-PA | 63 | GH23329-PA | 1..63 | 1..63 | 313 | 98.4 | Plus |
Dgri\GH19152-PA | 63 | GH19152-PA | 1..63 | 1..63 | 312 | 96.8 | Plus |
Dgri\GH19151-PA | 63 | GH19151-PA | 1..63 | 1..63 | 312 | 96.8 | Plus |
Dgri\GH18419-PA | 63 | GH18419-PA | 1..63 | 1..63 | 312 | 96.8 | Plus |
Dgri\GH23207-PA | 63 | GH23207-PA | 1..63 | 1..63 | 308 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CecC-PA | 63 | CG1373-PA | 1..63 | 1..63 | 311 | 100 | Plus |
CecA1-PA | 63 | CG1365-PA | 1..63 | 1..63 | 297 | 92.1 | Plus |
CecA2-PA | 63 | CG1367-PA | 1..63 | 1..63 | 297 | 92.1 | Plus |
CecB-PA | 63 | CG1878-PA | 1..63 | 1..63 | 276 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23259-PA | 186 | GI23259-PA | 124..186 | 1..63 | 306 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\CecIV-PA | 63 | GA15079-PA | 1..63 | 1..63 | 298 | 90.5 | Plus |
Dpse\CecIII-PA | 63 | GA12447-PA | 1..63 | 1..63 | 298 | 90.5 | Plus |
Dpse\CecV-PA | 63 | GA26855-PA | 1..63 | 1..63 | 298 | 90.5 | Plus |
Dpse\CecII-PA | 63 | GA17203-PA | 1..63 | 1..63 | 271 | 79.4 | Plus |
Dpse\CecI-PA | 63 | GA12435-PA | 1..63 | 1..63 | 242 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\CecC-PA | 63 | GM12871-PA | 1..63 | 1..63 | 315 | 100 | Plus |
Dsec\CecB-PA | 63 | GM12165-PA | 1..63 | 1..63 | 278 | 87.3 | Plus |
Dsec\CecA1-PA | 63 | GM12870-PA | 1..63 | 1..63 | 238 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\CecC-PA | 63 | GD21509-PA | 1..63 | 1..63 | 315 | 100 | Plus |
Dsim\CecB-PA | 63 | GD17190-PA | 1..63 | 1..63 | 278 | 87.3 | Plus |
Dsim\CecA1-PA | 63 | GD21508-PA | 1..63 | 1..63 | 238 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Cec1-PA | 63 | GJ10758-PA | 1..63 | 1..63 | 304 | 92.1 | Plus |
Dvir\Cec3-PA | 63 | GJ10755-PA | 1..63 | 1..63 | 304 | 92.1 | Plus |
Dvir\Cec2A-PA | 63 | GJ10757-PA | 1..63 | 1..63 | 303 | 90.5 | Plus |
Dvir\Cec2B-PA | 63 | GJ10406-PA | 1..63 | 1..63 | 303 | 90.5 | Plus |
Dvir\GJ10759-PA | 63 | GJ10759-PA | 1..63 | 1..63 | 229 | 69.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14120-PA | 63 | GK14120-PA | 1..63 | 1..63 | 304 | 92.1 | Plus |
Dwil\GK14123-PA | 63 | GK14123-PA | 1..63 | 1..63 | 303 | 90.5 | Plus |
Dwil\GK14124-PA | 63 | GK14124-PA | 1..63 | 1..63 | 303 | 93.7 | Plus |
Dwil\GK14122-PA | 63 | GK14122-PA | 1..63 | 1..63 | 291 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10867-PA | 63 | GE10867-PA | 1..63 | 1..63 | 305 | 93.7 | Plus |
Dyak\GE10866-PA | 63 | GE10866-PA | 1..63 | 1..63 | 299 | 92.1 | Plus |
Dyak\GE23398-PA | 63 | GE23398-PA | 1..63 | 1..63 | 285 | 90.5 | Plus |
Dyak\GE10868-PA | 64 | GE10868-PA | 1..61 | 1..55 | 139 | 54.8 | Plus |