Clone RH33561 Report

Search the DGRC for RH33561

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:335
Well:61
Vector:pFlc-1
Associated Gene/TranscriptCecC-RA
Protein status:RH33561.pep: gold
Preliminary Size:192
Sequenced Size:403

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1373 2002-01-01 Sim4 clustering to Release 2
CG1373 2002-04-26 Blastp of sequenced clone
CG1373 2003-01-01 Sim4 clustering to Release 3
CecC 2008-04-29 Release 5.5 accounting
CecC 2008-08-15 Release 5.9 accounting
CecC 2008-12-18 5.12 accounting

Clone Sequence Records

RH33561.complete Sequence

403 bp (403 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113583

> RH33561.complete
GATCAGTCGCTCAGTTTCCACAGCAGCTAAACAGCTAAATCGCAATCTAT
ATATATATATATATACTAAGGAATTAAACCTAGAAAATTCACCATGAACT
TCTACAAGATCTTCGTTTTCGTCGCCCTCATCCTGGCCATCAGCATTGGA
CAATCGGAAGCCGGTTGGCTGAAGAAACTTGGCAAGAGAATCGAGCGCAT
TGGCCAGCACACCCGGGATGCAACCATTCAAGGACTGGGAATTGCGCAAC
AGGCCGCCAATGTGGCAGCCACCGCCAGAGGATGAGCCTTTAATGTCCAT
CAAAGGACTCTACCAGGATAACGCGCGTTTAATTATACACACTTATTTAT
TTACCAGCCATAGAAATAAACTAGCTTACATCCCCGCAAAAAAAAAAAAA
AAA

RH33561.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
CecC-RA 485 CecC-RA 58..442 2..386 1925 100 Plus
CecA1-RA 474 CecA1-RA 187..383 89..285 610 87.3 Plus
CecA2-RA 480 CecA2-RA 79..261 90..272 585 87.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26039213..26039406 193..386 940 99 Plus
chr3R 27901430 chr3R 26038953..26039144 2..193 930 99 Plus
chr3R 27901430 chr3R 26034699..26034802 90..193 400 92.3 Plus
chr3R 27901430 chr3R 26033408..26033512 89..193 390 91.4 Plus
chr3R 27901430 chr3R 26036096..26036196 193..93 265 84.2 Minus
chr3R 27901430 chr3R 26034867..26034939 200..272 215 86.3 Plus
chr3R 27901430 chr3R 26033576..26033665 196..285 210 82.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30216745..30216938 193..386 970 100 Plus
3R 32079331 3R 30216485..30216676 2..193 960 100 Plus
3R 32079331 3R 30210943..30211047 89..193 405 92.4 Plus
3R 32079331 3R 30212234..30212337 90..193 400 92.3 Plus
3R 32079331 3R 30213626..30213726 193..93 220 81.2 Minus
3R 32079331 3R 30211111..30211200 196..285 210 82.2 Plus
3R 32079331 3R 30212402..30212474 200..272 200 84.9 Plus
3R 32079331 3R 30213476..30213565 285..196 195 81.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29957576..29957769 193..386 970 100 Plus
3R 31820162 3R 29957316..29957507 2..193 960 100 Plus
3R 31820162 3R 29951774..29951878 89..193 405 92.3 Plus
3R 31820162 3R 29953065..29953168 90..193 400 92.3 Plus
3R 31820162 3R 29954457..29954557 193..93 220 81.1 Minus
3R 31820162 3R 29951942..29952031 196..285 210 82.2 Plus
3R 31820162 3R 29953233..29953305 200..272 200 84.9 Plus
3R 31820162 3R 29954307..29954396 285..196 195 81.1 Minus
Blast to na_te.dros performed on 2019-03-16 07:30:13 has no hits.

RH33561.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:31:16 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26038952..26039143 1..192 98 -> Plus
chr3R 26039213..26039406 193..387 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:04 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 1..192 94..285 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:44 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 1..192 94..285 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:44:59 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 1..192 94..285 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:10 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 1..192 94..285 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:32:35 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 1..192 94..285 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:37 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 2..385 2..385 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:44 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 2..385 2..385 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:44:59 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 2..386 2..386 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:10 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 2..385 2..385 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:32:35 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 2..386 2..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:16 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30216484..30216675 1..192 99 -> Plus
3R 30216745..30216938 193..387 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:16 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30216484..30216675 1..192 99 -> Plus
3R 30216745..30216938 193..387 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:16 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30216484..30216675 1..192 99 -> Plus
3R 30216745..30216938 193..387 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:44:59 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26042206..26042397 1..192 99 -> Plus
arm_3R 26042467..26042660 193..387 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:51 Download gff for RH33561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29957315..29957506 1..192 99 -> Plus
3R 29957576..29957769 193..387 99   Plus

RH33561.hyp Sequence

Translation from 93 to 284

> RH33561.hyp
MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGI
AQQAANVAATARG*

RH33561.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
CecC-PA 63 CG1373-PA 1..63 1..63 311 100 Plus
CecA2-PA 63 CG1367-PA 1..63 1..63 297 92.1 Plus
CecA1-PA 63 CG1365-PA 1..63 1..63 297 92.1 Plus
CecB-PA 63 CG1878-PA 1..63 1..63 276 88.9 Plus

RH33561.pep Sequence

Translation from 93 to 284

> RH33561.pep
MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGI
AQQAANVAATARG*

RH33561.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18827-PA 63 GF18827-PA 1..63 1..63 301 90.5 Plus
Dana\GF18829-PA 63 GF18829-PA 1..63 1..63 276 85.7 Plus
Dana\GF16190-PA 63 GF16190-PA 1..63 1..63 232 90.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11739-PA 63 GG11739-PA 1..63 1..63 302 92.1 Plus
Dere\GG26130-PA 63 GG11740-PA 1..63 1..63 302 92.1 Plus
Dere\GG11950-PA 63 GG11950-PA 1..63 1..63 285 90.5 Plus
Dere\GG11742-PA 66 GG11742-PA 1..63 1..63 154 46 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23329-PA 63 GH23329-PA 1..63 1..63 313 98.4 Plus
Dgri\GH19152-PA 63 GH19152-PA 1..63 1..63 312 96.8 Plus
Dgri\GH19151-PA 63 GH19151-PA 1..63 1..63 312 96.8 Plus
Dgri\GH18419-PA 63 GH18419-PA 1..63 1..63 312 96.8 Plus
Dgri\GH23207-PA 63 GH23207-PA 1..63 1..63 308 93.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
CecC-PA 63 CG1373-PA 1..63 1..63 311 100 Plus
CecA1-PA 63 CG1365-PA 1..63 1..63 297 92.1 Plus
CecA2-PA 63 CG1367-PA 1..63 1..63 297 92.1 Plus
CecB-PA 63 CG1878-PA 1..63 1..63 276 88.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23259-PA 186 GI23259-PA 124..186 1..63 306 92.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\CecIV-PA 63 GA15079-PA 1..63 1..63 298 90.5 Plus
Dpse\CecIII-PA 63 GA12447-PA 1..63 1..63 298 90.5 Plus
Dpse\CecV-PA 63 GA26855-PA 1..63 1..63 298 90.5 Plus
Dpse\CecII-PA 63 GA17203-PA 1..63 1..63 271 79.4 Plus
Dpse\CecI-PA 63 GA12435-PA 1..63 1..63 242 90.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\CecC-PA 63 GM12871-PA 1..63 1..63 315 100 Plus
Dsec\CecB-PA 63 GM12165-PA 1..63 1..63 278 87.3 Plus
Dsec\CecA1-PA 63 GM12870-PA 1..63 1..63 238 90.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CecC-PA 63 GD21509-PA 1..63 1..63 315 100 Plus
Dsim\CecB-PA 63 GD17190-PA 1..63 1..63 278 87.3 Plus
Dsim\CecA1-PA 63 GD21508-PA 1..63 1..63 238 90.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Cec1-PA 63 GJ10758-PA 1..63 1..63 304 92.1 Plus
Dvir\Cec3-PA 63 GJ10755-PA 1..63 1..63 304 92.1 Plus
Dvir\Cec2A-PA 63 GJ10757-PA 1..63 1..63 303 90.5 Plus
Dvir\Cec2B-PA 63 GJ10406-PA 1..63 1..63 303 90.5 Plus
Dvir\GJ10759-PA 63 GJ10759-PA 1..63 1..63 229 69.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14120-PA 63 GK14120-PA 1..63 1..63 304 92.1 Plus
Dwil\GK14123-PA 63 GK14123-PA 1..63 1..63 303 90.5 Plus
Dwil\GK14124-PA 63 GK14124-PA 1..63 1..63 303 93.7 Plus
Dwil\GK14122-PA 63 GK14122-PA 1..63 1..63 291 88.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10867-PA 63 GE10867-PA 1..63 1..63 305 93.7 Plus
Dyak\GE10866-PA 63 GE10866-PA 1..63 1..63 299 92.1 Plus
Dyak\GE23398-PA 63 GE23398-PA 1..63 1..63 285 90.5 Plus
Dyak\GE10868-PA 64 GE10868-PA 1..61 1..55 139 54.8 Plus