Clone RH34376 Report

Search the DGRC for RH34376

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:343
Well:76
Vector:pFlc-1
Associated Gene/TranscriptCG31676-RA
Protein status:RH34376.pep: gold
Preliminary Size:561
Sequenced Size:1074

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14404 2002-01-01 Sim4 clustering to Release 2
CG31676 2002-11-12 Blastp of sequenced clone
CG31676 2003-01-01 Sim4 clustering to Release 3
CG31676 2008-04-29 Release 5.5 accounting
CG31676 2008-08-15 Release 5.9 accounting
CG31676 2008-12-18 5.12 accounting

Clone Sequence Records

RH34376.complete Sequence

1074 bp (1074 high quality bases) assembled on 2002-11-12

GenBank Submission: AY075543.1

> RH34376.complete
GATTTCGCAGTCAGTTCGTCAACGGGTCGCATGCGTGTTCGGAAAATCGC
GCAAAGCGAATGTTATTGTGGAGTATCGTTAGCTAAGGCAAATTCAAATA
CCCCTAAAGTGCAGTGCTTGTGCAGTGATATACCTGGAATCAACCGAGAA
ACGCATAAAAAGAAGGAATTATTGTATCATGGCCTACGGTTCAACCGGCT
GCCTCTTGCTGGGCCTTTTCTCCTTGCTGATGGTTTTCAATACAGCTTCC
GCGGTGCTGCGATGCTGGCGCTGTTCGACGGACGTCTCCAATGGCGAGTT
CTGCAACGATCCCTTCATGCCGGAGACCATTTCGGAGCAGCAGCGGTACT
GGAGCTACGTGAACTGCACCTACTCGGTGGGCGCCAAATCGGTGAATGCC
CGGCCTGTCTGCAAGAAACTGGTGCAAGAAGTCTACGGCAAGCGGGTGAT
TTCGCGTTCCTGTTTTTACGAGGACATGGACGACTCGGCGGACAAGTGCG
CCAATGACCAGACATCGTCCTACATAAAAACCGTCTACTGCCGCACCTGC
ACCACGGACGGTTGCAACGGAGCCAGTGGCGCCACTCCACGGGTCCTGCT
CCTCATGCTGCCCCTGTTGCTGGCAGCAGCCTTCCGGCACTTGCCGCTGT
GCAAATGAGCCAAAGGATCTGGCCCGGACTTAACTGCGGGACTTCAGGCT
GAAGTTGAACTGGCCGGGAATTTCGGTGCTTAGCCCGGACTTAACTGAAT
TTCTTCAACAAGTTTTAGTCACTTTGCCCTCACGAATCTGCACAAATCAC
AGACGAACAGGATGCCCCGGTTAGGCAAAGCCCGTCAATCGGGGTCACCC
TTTCGTCATCATCCGCGTAAATGTTACTGGGTCACCTCAGCCACGAAAAA
TCAAACAGTTACTCGTAGTCAGTACTCTACACCCATAATAAATCACTCGA
TCACACTTAACTTTGTTGTAATATGTACATCATGTAATATCTTTATTATT
GTATTTGTAATTGAACGGCGCTGCCTGAACGTATATAAATAAATCGTAAT
TAGATGGCAAAAAAAAAAAAAAAA

RH34376.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG31676-RA 1213 CG31676-RA 139..1192 4..1057 5225 99.7 Plus
CG31676.a 881 CG31676.a 69..881 245..1057 4035 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20847084..20847711 430..1057 3110 99.7 Plus
chr2L 23010047 chr2L 20839311..20839555 4..245 1115 98 Plus
chr2L 23010047 chr2L 20843870..20844058 243..431 900 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20848555..20849182 430..1057 3125 99.8 Plus
2L 23513712 2L 20840803..20841044 4..245 1195 99.6 Plus
2L 23513712 2L 20845340..20845528 243..431 930 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20848555..20849182 430..1057 3125 99.8 Plus
2L 23513712 2L 20840803..20841044 4..245 1195 99.5 Plus
2L 23513712 2L 20845340..20845528 243..431 930 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 14:23:10 has no hits.

RH34376.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:23:57 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20839308..20839555 1..245 97 -> Plus
chr2L 20843873..20844058 246..431 98 -> Plus
chr2L 20847086..20847711 432..1058 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:14 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 1..480 179..658 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:04:49 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 1..480 179..658 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:11:20 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 1..480 179..658 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:02 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 1..480 179..658 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:17 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 1..480 179..658 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:14 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 2..1057 2..1057 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:04:49 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 2..1057 2..1057 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:11:20 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 1..1056 2..1057 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:02 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 2..1057 2..1057 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:17 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
CG31676-RA 1..1056 2..1057 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:57 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20845343..20845528 246..431 99 -> Plus
2L 20840800..20841044 1..245 98 -> Plus
2L 20848557..20849182 432..1058 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:57 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20845343..20845528 246..431 99 -> Plus
2L 20840800..20841044 1..245 98 -> Plus
2L 20848557..20849182 432..1058 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:57 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20845343..20845528 246..431 99 -> Plus
2L 20840800..20841044 1..245 98 -> Plus
2L 20848557..20849182 432..1058 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:11:20 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20840800..20841044 1..245 98 -> Plus
arm_2L 20845343..20845528 246..431 99 -> Plus
arm_2L 20848557..20849182 432..1058 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:21 Download gff for RH34376.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20840800..20841044 1..245 98 -> Plus
2L 20845343..20845528 246..431 99 -> Plus
2L 20848557..20849182 432..1058 99   Plus

RH34376.hyp Sequence

Translation from 0 to 506

> RH34376.hyp
QFAVSLSTGRMRVRKIAQSECYCGVSLAKANSNTPKVQCLCSDIPGINRE
THKKKELLYHGLRFNRLPLAGPFLLADGFQYSFRGAAMLALFDGRLQWRV
LQRSLHAGDHFGAAAVLELRELHLLGGRQIGECPACLQETGARSLRQAGD
FAFLFLRGHGRLGGQVRQ*
Sequence RH34376.hyp has no blast hits.

RH34376.pep Sequence

Translation from 178 to 657

> RH34376.pep
MAYGSTGCLLLGLFSLLMVFNTASAVLRCWRCSTDVSNGEFCNDPFMPET
ISEQQRYWSYVNCTYSVGAKSVNARPVCKKLVQEVYGKRVISRSCFYEDM
DDSADKCANDQTSSYIKTVYCRTCTTDGCNGASGATPRVLLLMLPLLLAA
AFRHLPLCK*

RH34376.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20941-PA 159 GF20941-PA 3..142 2..141 597 85.7 Plus
Dana\GF20964-PA 167 GF20964-PA 35..143 27..132 163 33 Plus
Dana\GF13713-PA 155 GF13713-PA 9..139 11..151 161 32.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21259-PA 159 GG21259-PA 1..159 1..159 724 92.5 Plus
Dere\GG21261-PA 166 GG21261-PA 34..142 27..132 154 32.1 Plus
Dere\GG20404-PA 155 GG20404-PA 10..123 9..133 144 32.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10589-PA 155 GH10589-PA 25..134 25..134 535 90 Plus
Dgri\GH10590-PA 160 GH10590-PA 7..138 9..133 170 31.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31676-PB 159 CG31676-PB 1..159 1..159 857 100 Plus
CG31676-PA 159 CG31676-PA 1..159 1..159 857 100 Plus
twit-PA 166 CG9335-PA 34..157 27..146 184 33.1 Plus
CG6329-PF 155 CG6329-PF 10..138 9..150 176 33.8 Plus
CG6329-PE 155 CG6329-PE 10..138 9..150 176 33.8 Plus
CG6329-PD 155 CG6329-PD 10..138 9..150 176 33.8 Plus
CG6329-PB 155 CG6329-PB 10..138 9..150 176 33.8 Plus
CG6329-PC 155 CG6329-PC 10..138 9..150 176 33.8 Plus
CG6329-PA 155 CG6329-PA 10..138 9..150 176 33.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23176-PA 155 GI23176-PA 25..130 25..130 518 90.6 Plus
Dmoj\GI23187-PA 160 GI23187-PA 29..155 27..150 144 29.9 Plus
Dmoj\GI18639-PA 154 GI18639-PA 10..137 9..151 137 30.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18525-PA 157 GL18525-PA 3..137 2..136 618 83.7 Plus
Dper\GL18527-PA 161 GL18527-PA 4..153 9..147 175 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25671-PA 157 GA25671-PA 3..137 2..136 618 83.7 Plus
Dpse\GA21710-PA 166 GA21710-PA 9..158 9..147 175 29.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23377-PA 167 GM23377-PA 1..159 1..159 842 99.4 Plus
Dsec\GM23379-PA 166 GM23379-PA 34..157 27..146 176 33.1 Plus
Dsec\GM21492-PA 155 GM21492-PA 10..140 9..152 166 32.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24287-PA 159 GD24287-PA 1..159 1..159 846 100 Plus
Dsim\GD24289-PA 166 GD24289-PA 34..157 27..146 176 33.1 Plus
Dsim\GD10986-PA 155 GD10986-PA 10..140 9..152 170 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23675-PA 157 GJ23675-PA 26..133 25..132 519 88.9 Plus
Dvir\GJ23686-PA 160 GJ23686-PA 29..138 27..133 156 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15439-PA 159 GK15439-PA 21..140 18..137 572 88.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12881-PA 159 GE12881-PA 1..159 1..159 681 92.5 Plus
Dyak\GE12884-PA 166 GE12884-PA 34..158 27..147 178 33.6 Plus
Dyak\GE12564-PA 157 GE12564-PA 10..139 9..151 167 33.6 Plus