BDGP Sequence Production Resources |
Search the DGRC for RH34413
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 344 |
Well: | 13 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG11267-RA |
Protein status: | RH34413.pep: gold |
Preliminary Size: | 546 |
Sequenced Size: | 601 |
Gene | Date | Evidence |
---|---|---|
CG11267 | 2001-12-13 | Blastp of sequenced clone |
CG11267 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11267 | 2008-04-29 | Release 5.5 accounting |
CG11267 | 2008-08-15 | Release 5.9 accounting |
CG11267 | 2008-12-18 | 5.12 accounting |
601 bp (601 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070696
> RH34413.complete GAGTCCCGCATCTAGCGAGAATAGTTACGCCGGCACGTGTAGTTGAGTAA AAAGTTCACTCATTAACTTTTATCAACCGCTCCAGTTTGCATTTAAGAAT TAAAATGGCCGCCGCTATCAAGAAGATCATCCCCATGCTGGACCGCATCC TAATCCAGCGTGCCGAGGCGCTGACCAAGACGAAAGGAGGCATTGTTTTG CCGGAGAAAGCGGTGGGCAAAGTACTTGAGGGCACCGTTCTGGCCGTAGG CCCTGGCACCCGTAATGCCTCCACTGGCAACCACATTCCCATTGGCGTGA AGGAGGGCGATCGTGTTCTGCTGCCCGAATTCGGTGGCACCAAGGTGAAC CTAGAGGGTGACCAGAAGGAGCTGTTCCTCTTCCGCGAGTCCGACATCCT GGCCAAATTGGAGTAGATCTCGCCTCCGGACACTGTCTCACAATTCTATG AATTCTATGCTTTTTATTAGTATGTAACACACCCACAAACCCGAAACTAA AAACTACAATAAAAGCTCATGCAATATTTTTGTTTGCATTGCGCATGGAC CGTCATTGAATAAATTTCGAGTTACTTGTTAAAACTAAAAAAAAAAAAAA A
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 13006882..13007199 | 270..586 | 1510 | 99.1 | Plus |
chr3L | 24539361 | chr3L | 13006651..13006813 | 107..269 | 815 | 100 | Plus |
chr3L | 24539361 | chr3L | 13006354..13006460 | 2..108 | 535 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 13016587..13016904 | 270..587 | 1590 | 100 | Plus |
3L | 28110227 | 3L | 13016356..13016518 | 107..269 | 815 | 100 | Plus |
3L | 28110227 | 3L | 13016059..13016165 | 2..108 | 535 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 13009687..13010004 | 270..587 | 1590 | 100 | Plus |
3L | 28103327 | 3L | 13009456..13009618 | 107..269 | 815 | 100 | Plus |
3L | 28103327 | 3L | 13009159..13009265 | 2..108 | 535 | 100 | Plus |
3R | 31820162 | 3R | 13838673..13838725 | 168..116 | 160 | 86.7 | Minus |
3R | 31820162 | 3R | 13838495..13838549 | 346..292 | 155 | 85.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 13006352..13006459 | 1..107 | 99 | -> | Plus |
chr3L | 13006652..13006813 | 108..269 | 100 | -> | Plus |
chr3L | 13006882..13007199 | 270..586 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 1..312 | 105..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 1..312 | 105..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 1..312 | 105..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 1..312 | 105..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 1..312 | 105..416 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 1..587 | 1..586 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 1..587 | 1..586 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 8..594 | 1..586 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 1..587 | 1..586 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11267-RA | 8..594 | 1..586 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13016057..13016164 | 1..107 | 99 | -> | Plus |
3L | 13016357..13016518 | 108..269 | 100 | -> | Plus |
3L | 13016587..13016903 | 270..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13016057..13016164 | 1..107 | 99 | -> | Plus |
3L | 13016357..13016518 | 108..269 | 100 | -> | Plus |
3L | 13016587..13016903 | 270..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13016057..13016164 | 1..107 | 99 | -> | Plus |
3L | 13016357..13016518 | 108..269 | 100 | -> | Plus |
3L | 13016587..13016903 | 270..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 13009157..13009264 | 1..107 | 99 | -> | Plus |
arm_3L | 13009457..13009618 | 108..269 | 100 | -> | Plus |
arm_3L | 13009687..13010003 | 270..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13009687..13010003 | 270..586 | 100 | Plus | |
3L | 13009157..13009264 | 1..107 | 99 | -> | Plus |
3L | 13009457..13009618 | 108..269 | 100 | -> | Plus |
Translation from 104 to 415
> RH34413.hyp MAAAIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGP GTRNASTGNHIPIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILA KLE*
Translation from 104 to 415
> RH34413.pep MAAAIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGP GTRNASTGNHIPIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILA KLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24628-PA | 104 | GF24628-PA | 1..104 | 1..103 | 478 | 93.3 | Plus |
Dana\GF18793-PA | 102 | GF18793-PA | 1..102 | 1..103 | 340 | 65 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15616-PA | 103 | GG15616-PA | 1..103 | 1..103 | 510 | 99 | Plus |
Dere\GG21544-PA | 102 | GG21544-PA | 1..102 | 1..103 | 338 | 64.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17079-PA | 104 | GH17079-PA | 1..104 | 1..103 | 460 | 87.5 | Plus |
Dgri\GH22450-PA | 102 | GH22450-PA | 1..102 | 1..103 | 338 | 63.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11267-PA | 103 | CG11267-PA | 1..103 | 1..103 | 509 | 100 | Plus |
CG9920-PA | 102 | CG9920-PA | 1..102 | 1..103 | 333 | 64.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11679-PA | 94 | GI11679-PA | 1..94 | 11..103 | 421 | 90.4 | Plus |
Dmoj\GI24558-PA | 102 | GI24558-PA | 1..102 | 1..103 | 339 | 65 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25265-PA | 103 | GL25265-PA | 1..103 | 1..103 | 491 | 96.1 | Plus |
Dper\GL23313-PA | 102 | GL23313-PA | 1..102 | 1..103 | 336 | 65 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10877-PA | 103 | GA10877-PA | 1..103 | 1..103 | 491 | 96.1 | Plus |
Dpse\GA22124-PA | 102 | GA22124-PA | 1..102 | 1..103 | 338 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25388-PA | 103 | GM25388-PA | 1..103 | 1..103 | 510 | 99 | Plus |
Dsec\GM25890-PA | 102 | GM25890-PA | 1..102 | 1..103 | 336 | 64.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14421-PA | 103 | GD14421-PA | 1..103 | 1..103 | 510 | 99 | Plus |
Dsim\GD20460-PA | 116 | GD20460-PA | 21..116 | 7..103 | 317 | 63.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11351-PA | 94 | GJ11351-PA | 1..94 | 11..103 | 420 | 89.4 | Plus |
Dvir\GJ22624-PA | 102 | GJ22624-PA | 1..102 | 1..103 | 348 | 65 | Plus |