Clone RH34413 Report

Search the DGRC for RH34413

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:344
Well:13
Vector:pFlc-1
Associated Gene/TranscriptCG11267-RA
Protein status:RH34413.pep: gold
Preliminary Size:546
Sequenced Size:601

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11267 2001-12-13 Blastp of sequenced clone
CG11267 2002-01-01 Sim4 clustering to Release 2
CG11267 2008-04-29 Release 5.5 accounting
CG11267 2008-08-15 Release 5.9 accounting
CG11267 2008-12-18 5.12 accounting

Clone Sequence Records

RH34413.complete Sequence

601 bp (601 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070696

> RH34413.complete
GAGTCCCGCATCTAGCGAGAATAGTTACGCCGGCACGTGTAGTTGAGTAA
AAAGTTCACTCATTAACTTTTATCAACCGCTCCAGTTTGCATTTAAGAAT
TAAAATGGCCGCCGCTATCAAGAAGATCATCCCCATGCTGGACCGCATCC
TAATCCAGCGTGCCGAGGCGCTGACCAAGACGAAAGGAGGCATTGTTTTG
CCGGAGAAAGCGGTGGGCAAAGTACTTGAGGGCACCGTTCTGGCCGTAGG
CCCTGGCACCCGTAATGCCTCCACTGGCAACCACATTCCCATTGGCGTGA
AGGAGGGCGATCGTGTTCTGCTGCCCGAATTCGGTGGCACCAAGGTGAAC
CTAGAGGGTGACCAGAAGGAGCTGTTCCTCTTCCGCGAGTCCGACATCCT
GGCCAAATTGGAGTAGATCTCGCCTCCGGACACTGTCTCACAATTCTATG
AATTCTATGCTTTTTATTAGTATGTAACACACCCACAAACCCGAAACTAA
AAACTACAATAAAAGCTCATGCAATATTTTTGTTTGCATTGCGCATGGAC
CGTCATTGAATAAATTTCGAGTTACTTGTTAAAACTAAAAAAAAAAAAAA
A

RH34413.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267.b 961 CG11267.b 136..721 2..587 2930 100 Plus
CG11267-RA 805 CG11267-RA 136..721 2..587 2930 100 Plus
CG11267.a 500 CG11267.a 18..497 108..587 2400 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13006882..13007199 270..586 1510 99.1 Plus
chr3L 24539361 chr3L 13006651..13006813 107..269 815 100 Plus
chr3L 24539361 chr3L 13006354..13006460 2..108 535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13016587..13016904 270..587 1590 100 Plus
3L 28110227 3L 13016356..13016518 107..269 815 100 Plus
3L 28110227 3L 13016059..13016165 2..108 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13009687..13010004 270..587 1590 100 Plus
3L 28103327 3L 13009456..13009618 107..269 815 100 Plus
3L 28103327 3L 13009159..13009265 2..108 535 100 Plus
3R 31820162 3R 13838673..13838725 168..116 160 86.7 Minus
3R 31820162 3R 13838495..13838549 346..292 155 85.4 Minus
Blast to na_te.dros performed on 2019-03-15 20:27:33 has no hits.

RH34413.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:28:42 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13006352..13006459 1..107 99 -> Plus
chr3L 13006652..13006813 108..269 100 -> Plus
chr3L 13006882..13007199 270..586 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:17 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 1..312 105..416 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:24 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 1..312 105..416 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:47 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 1..312 105..416 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:49 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 1..312 105..416 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:34 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 1..312 105..416 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:49 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 1..587 1..586 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:24 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 1..587 1..586 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:47 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 8..594 1..586 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:50 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 1..587 1..586 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:34 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 8..594 1..586 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:28:42 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13016057..13016164 1..107 99 -> Plus
3L 13016357..13016518 108..269 100 -> Plus
3L 13016587..13016903 270..586 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:28:42 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13016057..13016164 1..107 99 -> Plus
3L 13016357..13016518 108..269 100 -> Plus
3L 13016587..13016903 270..586 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:28:42 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13016057..13016164 1..107 99 -> Plus
3L 13016357..13016518 108..269 100 -> Plus
3L 13016587..13016903 270..586 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:47 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13009157..13009264 1..107 99 -> Plus
arm_3L 13009457..13009618 108..269 100 -> Plus
arm_3L 13009687..13010003 270..586 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:08:02 Download gff for RH34413.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13009687..13010003 270..586 100   Plus
3L 13009157..13009264 1..107 99 -> Plus
3L 13009457..13009618 108..269 100 -> Plus

RH34413.hyp Sequence

Translation from 104 to 415

> RH34413.hyp
MAAAIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGP
GTRNASTGNHIPIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILA
KLE*

RH34413.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267-PA 103 CG11267-PA 1..103 1..103 509 100 Plus
CG9920-PA 102 CG9920-PA 1..102 1..103 333 64.1 Plus

RH34413.pep Sequence

Translation from 104 to 415

> RH34413.pep
MAAAIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGP
GTRNASTGNHIPIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILA
KLE*

RH34413.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24628-PA 104 GF24628-PA 1..104 1..103 478 93.3 Plus
Dana\GF18793-PA 102 GF18793-PA 1..102 1..103 340 65 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15616-PA 103 GG15616-PA 1..103 1..103 510 99 Plus
Dere\GG21544-PA 102 GG21544-PA 1..102 1..103 338 64.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17079-PA 104 GH17079-PA 1..104 1..103 460 87.5 Plus
Dgri\GH22450-PA 102 GH22450-PA 1..102 1..103 338 63.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267-PA 103 CG11267-PA 1..103 1..103 509 100 Plus
CG9920-PA 102 CG9920-PA 1..102 1..103 333 64.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11679-PA 94 GI11679-PA 1..94 11..103 421 90.4 Plus
Dmoj\GI24558-PA 102 GI24558-PA 1..102 1..103 339 65 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25265-PA 103 GL25265-PA 1..103 1..103 491 96.1 Plus
Dper\GL23313-PA 102 GL23313-PA 1..102 1..103 336 65 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10877-PA 103 GA10877-PA 1..103 1..103 491 96.1 Plus
Dpse\GA22124-PA 102 GA22124-PA 1..102 1..103 338 66 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25388-PA 103 GM25388-PA 1..103 1..103 510 99 Plus
Dsec\GM25890-PA 102 GM25890-PA 1..102 1..103 336 64.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14421-PA 103 GD14421-PA 1..103 1..103 510 99 Plus
Dsim\GD20460-PA 116 GD20460-PA 21..116 7..103 317 63.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11351-PA 94 GJ11351-PA 1..94 11..103 420 89.4 Plus
Dvir\GJ22624-PA 102 GJ22624-PA 1..102 1..103 348 65 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17350-PA 104 GK17350-PA 1..104 1..103 473 92.3 Plus
Dwil\GK10911-PA 102 GK10911-PA 1..102 1..103 347 66 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21943-PA 103 GE21943-PA 1..103 1..103 510 99 Plus
Dyak\GE10065-PA 102 GE10065-PA 1..102 1..103 335 64.1 Plus