BDGP Sequence Production Resources |
Search the DGRC for RH34416
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 344 |
Well: | 16 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Sem1-RA |
Protein status: | RH34416.pep: gold |
Preliminary Size: | 240 |
Sequenced Size: | 444 |
Gene | Date | Evidence |
---|---|---|
CG13779 | 2001-12-13 | Blastp of sequenced clone |
CG13779 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13779 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13779 | 2008-04-29 | Release 5.5 accounting |
CG13779 | 2008-08-15 | Release 5.9 accounting |
CG13779 | 2008-12-18 | 5.12 accounting |
444 bp (444 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070697
> RH34416.complete GACACACAATTAAAAGTGACTGGCATCATTTAGCAACAAAAAACGCGAAT AGCGTCAAAAACATTGTTTTATCGCCGTTGGAATTAATAAAAGCACACAA AATGTCTGCCCCAGATAAGGAAAAGGAGAAAGAGAAGGAGGAGACCAACA ACAAGAGCGAAGACTTGGGTCTCCTGGAGGAGGACGACGAGTTCGAAGAG TTTCCCGCCGAAGATTTCCGCGTTGGCGACGACGAGGAAGAGCTAAATGT GTGGGAGGACAACTGGGACGACGACAACGTGGAGGACGACTTCAGCCAGC AGTTGAAGGCCCATTTGGAGAGCAAGAAAATGGAAACGTAAACCGGCACC GACCCCTTTGTTCAGTCCTAACCATAAAAACGAGCTGAGCTGTTTTGCAT TAATAGAATAAAATCAGTATATTAAGTGAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 7063312..7063526 | 214..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13779-RA | 1..240 | 102..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13779-RA | 1..240 | 102..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13779-RA | 1..240 | 102..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13779-RA | 1..240 | 102..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sem1-RA | 1..240 | 102..341 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13779-RA | 1..428 | 1..428 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13779-RA | 1..428 | 1..428 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13779-RA | 2..427 | 3..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13779-RA | 1..428 | 1..428 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sem1-RA | 2..427 | 3..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 7063985..7064197 | 1..213 | 99 | -> | Plus |
2L | 7064253..7064467 | 214..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 7063985..7064197 | 1..213 | 99 | -> | Plus |
2L | 7064253..7064467 | 214..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 7063985..7064197 | 1..213 | 99 | -> | Plus |
2L | 7064253..7064467 | 214..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 7063985..7064197 | 1..213 | 99 | -> | Plus |
arm_2L | 7064253..7064467 | 214..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 7063985..7064197 | 1..213 | 99 | -> | Plus |
2L | 7064253..7064467 | 214..428 | 100 | Plus |
Translation from 2 to 340
> RH34416.hyp HTIKSDWHHLATKNANSVKNIVLSPLELIKAHKMSAPDKEKEKEKEETNN KSEDLGLLEEDDEFEEFPAEDFRVGDDEEELNVWEDNWDDDNVEDDFSQQ LKAHLESKKMET*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sem1-PA | 79 | CG13779-PA | 1..79 | 34..112 | 422 | 100 | Plus |
Translation from 101 to 340
> RH34416.pep MSAPDKEKEKEKEETNNKSEDLGLLEEDDEFEEFPAEDFRVGDDEEELNV WEDNWDDDNVEDDFSQQLKAHLESKKMET*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20769-PA | 79 | GF20769-PA | 1..79 | 1..79 | 371 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10460-PA | 79 | GG10460-PA | 1..79 | 1..79 | 375 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10099-PA | 79 | GH10099-PA | 1..79 | 1..79 | 237 | 88.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sem1-PA | 79 | CG13779-PA | 1..79 | 1..79 | 422 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14386-PA | 79 | GI14386-PA | 1..79 | 1..79 | 249 | 92.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14107-PA | 79 | GL14107-PA | 1..79 | 1..79 | 366 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12520-PA | 79 | GA12520-PA | 1..79 | 1..79 | 366 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16322-PA | 79 | GM16322-PA | 1..79 | 1..79 | 380 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23452-PA | 554 | GD23452-PA | 480..554 | 7..79 | 227 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16256-PA | 79 | GJ16256-PA | 1..79 | 1..79 | 245 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24292-PA | 79 | GK24292-PA | 1..79 | 1..79 | 371 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14384-PA | 79 | GE14384-PA | 1..79 | 1..79 | 375 | 98.7 | Plus |