Clone RH34416 Report

Search the DGRC for RH34416

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:344
Well:16
Vector:pFlc-1
Associated Gene/TranscriptSem1-RA
Protein status:RH34416.pep: gold
Preliminary Size:240
Sequenced Size:444

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13779 2001-12-13 Blastp of sequenced clone
CG13779 2002-01-01 Sim4 clustering to Release 2
CG13779 2003-01-01 Sim4 clustering to Release 3
CG13779 2008-04-29 Release 5.5 accounting
CG13779 2008-08-15 Release 5.9 accounting
CG13779 2008-12-18 5.12 accounting

Clone Sequence Records

RH34416.complete Sequence

444 bp (444 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070697

> RH34416.complete
GACACACAATTAAAAGTGACTGGCATCATTTAGCAACAAAAAACGCGAAT
AGCGTCAAAAACATTGTTTTATCGCCGTTGGAATTAATAAAAGCACACAA
AATGTCTGCCCCAGATAAGGAAAAGGAGAAAGAGAAGGAGGAGACCAACA
ACAAGAGCGAAGACTTGGGTCTCCTGGAGGAGGACGACGAGTTCGAAGAG
TTTCCCGCCGAAGATTTCCGCGTTGGCGACGACGAGGAAGAGCTAAATGT
GTGGGAGGACAACTGGGACGACGACAACGTGGAGGACGACTTCAGCCAGC
AGTTGAAGGCCCATTTGGAGAGCAAGAAAATGGAAACGTAAACCGGCACC
GACCCCTTTGTTCAGTCCTAACCATAAAAACGAGCTGAGCTGTTTTGCAT
TAATAGAATAAAATCAGTATATTAAGTGAAAAAAAAAAAAAAAA

RH34416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13779-RA 492 CG13779-RA 67..492 3..428 2130 100 Plus
Nuf2-RA 1333 Nuf2-RA 1295..1333 428..390 195 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7063310..7063526 212..428 1085 100 Plus
chr2L 23010047 chr2L 7063046..7063260 3..217 1045 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7064251..7064467 212..428 1085 100 Plus
2L 23513712 2L 7063987..7064197 3..213 1055 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7064251..7064467 212..428 1085 100 Plus
2L 23513712 2L 7063987..7064197 3..213 1055 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:33:23 has no hits.

RH34416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:34:19 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7063312..7063526 214..428 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:18 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 1..240 102..341 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:00 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 1..240 102..341 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:15:28 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 1..240 102..341 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:21:59 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 1..240 102..341 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:23:48 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
Sem1-RA 1..240 102..341 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:20 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 1..428 1..428 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:00 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 1..428 1..428 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:15:28 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 2..427 3..428 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:00 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 1..428 1..428 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:23:48 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
Sem1-RA 2..427 3..428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:19 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7063985..7064197 1..213 99 -> Plus
2L 7064253..7064467 214..428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:19 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7063985..7064197 1..213 99 -> Plus
2L 7064253..7064467 214..428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:19 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7063985..7064197 1..213 99 -> Plus
2L 7064253..7064467 214..428 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:15:28 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7063985..7064197 1..213 99 -> Plus
arm_2L 7064253..7064467 214..428 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:39 Download gff for RH34416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7063985..7064197 1..213 99 -> Plus
2L 7064253..7064467 214..428 100   Plus

RH34416.hyp Sequence

Translation from 2 to 340

> RH34416.hyp
HTIKSDWHHLATKNANSVKNIVLSPLELIKAHKMSAPDKEKEKEKEETNN
KSEDLGLLEEDDEFEEFPAEDFRVGDDEEELNVWEDNWDDDNVEDDFSQQ
LKAHLESKKMET*

RH34416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
Sem1-PA 79 CG13779-PA 1..79 34..112 422 100 Plus

RH34416.pep Sequence

Translation from 101 to 340

> RH34416.pep
MSAPDKEKEKEKEETNNKSEDLGLLEEDDEFEEFPAEDFRVGDDEEELNV
WEDNWDDDNVEDDFSQQLKAHLESKKMET*

RH34416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20769-PA 79 GF20769-PA 1..79 1..79 371 97.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10460-PA 79 GG10460-PA 1..79 1..79 375 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10099-PA 79 GH10099-PA 1..79 1..79 237 88.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Sem1-PA 79 CG13779-PA 1..79 1..79 422 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14386-PA 79 GI14386-PA 1..79 1..79 249 92.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14107-PA 79 GL14107-PA 1..79 1..79 366 96.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12520-PA 79 GA12520-PA 1..79 1..79 366 96.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16322-PA 79 GM16322-PA 1..79 1..79 380 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23452-PA 554 GD23452-PA 480..554 7..79 227 66.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16256-PA 79 GJ16256-PA 1..79 1..79 245 89.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24292-PA 79 GK24292-PA 1..79 1..79 371 97.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14384-PA 79 GE14384-PA 1..79 1..79 375 98.7 Plus