Clone RH35959 Report

Search the DGRC for RH35959

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:359
Well:59
Vector:pFlc-1
Associated Gene/Transcriptl(2)k09913-RD
Protein status:RH35959.pep: gold
Preliminary Size:1900
Sequenced Size:1459

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3082 2002-10-18 Blastp of sequenced clone
l(2)k09913 2008-04-29 Release 5.5 accounting
l(2)k09913 2008-08-15 Release 5.9 accounting
l(2)k09913 2008-12-18 5.12 accounting

Clone Sequence Records

RH35959.complete Sequence

1459 bp (1459 high quality bases) assembled on 2002-10-18

GenBank Submission: BT001813

> RH35959.complete
GACACACACACACATCAGCTGAAATAACTATGTACCTTCCATGGGGATTG
GGAATGTAAGCTCGCCTCAATTCCGCTCAACTATCCGTGATCGTTCCACT
GGATCGCTGGACTATATGCTATATAATGTGGATCAGTCAGTCGGTCAAAG
TCGTTGCACCTGCTTAGTTTTATCTTCGATATGGACTTCCTAATTGAAAT
AACATTACTGGTCATATTGGCAATTATACTGCTGAAGATCTATCATCGGG
CGAAACGTAGTGCCATGGCGCCGTCGAACAATCGCCGGTACTTATCCTCG
CAGGATATTACCAAGAACATGACCCTGTACACCAGCACCAAGACCCAAGT
TGAGGTGGATCCCAAGACGCTGGCCTTCAAGAAGCCCACTGGCAACCCAC
TGGTTCTCATGATGGCCTGGCTGATGGCCAAGCAGAAGCATCTGAAGAAG
TATGCCCAGATCTACACTGAGATGGGATTCGATGTGGTGGTGGTGCACAT
TACGCCGTGGCAGCTACTCTGGCCGGTCAAAGGATCCCAGGTGGTGGCCG
CCGAGACTATTCGATTCCTGGAGAACAACAAGTCGTACGAACCCATTGTG
ATGCATGGCTTCTCCGTGGGCGCCTACCAGCTGGGCGAGATCATGCTGCA
GATGTCGCGCGACATGGATCGCTATGGTAGCATTCTGGACCGCTTCGTGT
GCCAGGTGTGGGACAGCGCCGCCGACATCACCGAGATCCCGGTGGGCGTG
CCCAAGTCGATCTTCCCGAGGAACGAGCGAATGCAGAGCGCCCTGCGCAA
CTATACGCTGTACCACCTGAAGACATTCCACAACCAGGCCACCATCCACT
ACATGCGCTCCAGCCAGATGTTCCACTCCACGCTGCTCAAGGCCCCGGCG
CTGTTCTTCGTGTCCGACAACGATCCCATCGGTCCGCCGTCCTCCAACCA
GTCCGTTCGCGAGGACTGGGAGCGTGCGAACATCAAGGTTACCTTCAAGT
GCTGGGAGCGGTCCCAGCACGCCGCCCACTATATACGGCATCGCGAGGAG
TACCTGCAGACGCTGTTCCAGCATCTGGAGACCTGCGGTGTCTTGGAGGC
CATCGGCGTGCCGAAGCGCGCCAAGTTGTAGGTGTCTCTAACGAGGAGCG
GCTGATCAGTTCAGTGATATACATTTATTCAAGAATCAATGCGATTATGA
TTTTACCCTAGTTGCTAAGACCTAAAGATTAACGAGCAATGTAAAACCAA
TGTCCTCTTTGAATGATTATGATCTGTGTGTCTCTCGCGAGGCAGAATCT
TCAAAAGCCCGCACGGGAAATTCCTAGGCTAAGCTTAAAGTCGTATTTCA
TCAACCGAGAGAAGAATGCACTACGCCTCTATATTGTTACATATATTTTG
AGATCGCTGCAAAACAGCTAAATAAAGTAATTTAAATGATACGAAAAAAA
AAAAAAAAA

RH35959.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)k09913-RD 1457 l(2)k09913-RD 2..1445 2..1445 7220 100 Plus
l(2)k09913-RA 1915 l(2)k09913-RA 722..1909 258..1445 5940 100 Plus
l(2)k09913-RC 2029 l(2)k09913-RC 830..2017 258..1445 5940 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18957416..18958322 537..1443 4505 99.8 Plus
chr2R 21145070 chr2R 18957072..18957355 259..542 1360 98.6 Plus
chr2R 21145070 chr2R 18955871..18956127 2..258 1285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23070961..23071869 537..1445 4545 100 Plus
2R 25286936 2R 23070607..23070900 259..552 1425 99 Plus
2R 25286936 2R 23069406..23069662 2..258 1285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23072160..23073068 537..1445 4545 100 Plus
2R 25260384 2R 23071806..23072099 259..552 1425 98.9 Plus
2R 25260384 2R 23070605..23070861 2..258 1285 100 Plus
Blast to na_te.dros performed 2019-03-16 07:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1b 5171 Rt1b RT1B 5150bp 4171..4239 793..860 126 66.7 Plus
gypsy6 7826 gypsy6 GYPSY6 7826bp 7000..7097 772..866 113 60.2 Plus

RH35959.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:33:06 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18955870..18956127 1..258 99 -> Plus
chr2R 18957072..18957353 259..540 98 -> Plus
chr2R 18957420..18958322 541..1443 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:30 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 1..951 181..1131 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:09:55 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 1..951 181..1131 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:45:09 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 1..951 181..1131 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:00:48 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 1..951 181..1131 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:33:18 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 1..951 181..1131 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:31:01 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 2..1443 2..1443 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:09:55 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 2..1443 2..1443 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:45:09 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 2..1443 2..1443 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:00:49 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 2..1443 2..1443 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:33:18 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k09913-RD 2..1443 2..1443 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:06 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23070607..23070888 259..540 100 -> Plus
2R 23069405..23069662 1..258 99 -> Plus
2R 23070965..23071867 541..1443 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:06 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23070607..23070888 259..540 100 -> Plus
2R 23069405..23069662 1..258 99 -> Plus
2R 23070965..23071867 541..1443 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:06 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23070607..23070888 259..540 100 -> Plus
2R 23069405..23069662 1..258 99 -> Plus
2R 23070965..23071867 541..1443 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:45:09 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18956928..18957185 1..258 99 -> Plus
arm_2R 18958130..18958411 259..540 100 -> Plus
arm_2R 18958488..18959390 541..1443 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:32:21 Download gff for RH35959.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23070622..23070879 1..258 99 -> Plus
2R 23071824..23072105 259..540 100 -> Plus
2R 23072182..23073084 541..1443 100   Plus

RH35959.pep Sequence

Translation from 180 to 1130

> RH35959.pep
MDFLIEITLLVILAIILLKIYHRAKRSAMAPSNNRRYLSSQDITKNMTLY
TSTKTQVEVDPKTLAFKKPTGNPLVLMMAWLMAKQKHLKKYAQIYTEMGF
DVVVVHITPWQLLWPVKGSQVVAAETIRFLENNKSYEPIVMHGFSVGAYQ
LGEIMLQMSRDMDRYGSILDRFVCQVWDSAADITEIPVGVPKSIFPRNER
MQSALRNYTLYHLKTFHNQATIHYMRSSQMFHSTLLKAPALFFVSDNDPI
GPPSSNQSVREDWERANIKVTFKCWERSQHAAHYIRHREEYLQTLFQHLE
TCGVLEAIGVPKRAKL*

RH35959.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13561-PA 417 GF13561-PA 102..417 1..316 1549 91.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\l(2)k09913-PA 388 GG22823-PA 96..388 24..316 1534 94.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20830-PA 389 GH20830-PA 96..389 23..316 1461 87.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)k09913-PD 316 CG3082-PD 1..316 1..316 1652 100 Plus
l(2)k09913-PF 388 CG3082-PF 96..388 24..316 1533 99.3 Plus
l(2)k09913-PE 389 CG3082-PE 97..389 24..316 1533 99.3 Plus
l(2)k09913-PC 389 CG3082-PC 97..389 24..316 1533 99.3 Plus
l(2)k09913-PA 389 CG3082-PA 97..389 24..316 1533 99.3 Plus
l(2)k09913-PB 389 CG3082-PB 97..389 24..316 1533 99.3 Plus
l(2)k09913-PI 288 CG3082-PI 1..288 29..316 1522 100 Plus
l(2)k09913-PH 288 CG3082-PH 1..288 29..316 1522 100 Plus
l(2)k09913-PG 288 CG3082-PG 1..288 29..316 1522 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20930-PA 394 GI20930-PA 104..394 26..316 1466 89 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11302-PA 417 GL11302-PA 102..417 1..316 1562 90.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15913-PA 417 GA15913-PA 102..417 1..316 1563 90.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15981-PA 389 GM15981-PA 97..389 24..316 1582 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11735-PA 336 GD11735-PA 21..336 1..316 1704 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20657-PA 394 GJ20657-PA 105..394 27..316 1476 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19549-PA 392 GK19549-PA 93..392 17..316 1434 84.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\l(2)k09913-PA 388 GE14258-PA 96..388 24..316 1564 96.2 Plus

RH35959.hyp Sequence

Translation from 180 to 1130

> RH35959.hyp
MDFLIEITLLVILAIILLKIYHRAKRSAMAPSNNRRYLSSQDITKNMTLY
TSTKTQVEVDPKTLAFKKPTGNPLVLMMAWLMAKQKHLKKYAQIYTEMGF
DVVVVHITPWQLLWPVKGSQVVAAETIRFLENNKSYEPIVMHGFSVGAYQ
LGEIMLQMSRDMDRYGSILDRFVCQVWDSAADITEIPVGVPKSIFPRNER
MQSALRNYTLYHLKTFHNQATIHYMRSSQMFHSTLLKAPALFFVSDNDPI
GPPSSNQSVREDWERANIKVTFKCWERSQHAAHYIRHREEYLQTLFQHLE
TCGVLEAIGVPKRAKL*

RH35959.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)k09913-PD 316 CG3082-PD 1..316 1..316 1652 100 Plus
l(2)k09913-PF 388 CG3082-PF 96..388 24..316 1533 99.3 Plus
l(2)k09913-PE 389 CG3082-PE 97..389 24..316 1533 99.3 Plus
l(2)k09913-PC 389 CG3082-PC 97..389 24..316 1533 99.3 Plus
l(2)k09913-PA 389 CG3082-PA 97..389 24..316 1533 99.3 Plus