Clone RH37294 Report

Search the DGRC for RH37294

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:372
Well:94
Vector:pFlc-1
Associated Gene/TranscriptCG15522-RA
Protein status:RH37294.pep: gold
Preliminary Size:522
Sequenced Size:1119

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15522 2001-12-17 Blastp of sequenced clone
CG15522 2002-01-01 Sim4 clustering to Release 2
CG15522 2003-01-01 Sim4 clustering to Release 3
CG15522 2008-04-29 Release 5.5 accounting
CG15522 2008-08-15 Release 5.9 accounting
CG15522 2008-12-18 5.12 accounting

Clone Sequence Records

RH37294.complete Sequence

1119 bp (1119 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071720

> RH37294.complete
CACAGTTCCCGACTGGGCGTCCGGGCATTCAGACCGCTCGCAAGGATAAC
GCGCAAGGATCCGAGCGAACGCGACGAGTAAATAAAGCATAAATAATACA
ATTAAAAGTTGAGCGCGCTCCCTTCGCAAAGGACATTCCCACACTTGTAG
CCCACTTCCTTCGGGCAGTGCAACACAAAAGTGCAGTCATTAATTAATTT
AATGCATATGTACCCCATCCTGGCAGCACAAGAGTCGAGCCAAGCCGACG
ATATCCTATAAAGCGAGCACTAGATACCACCGATAGCACCATGTTCCCAC
CCAGTTCTGAAGGACACATCCGAGTGTCTCGACGTGACTAGGCCAAGCAG
GCCCCACAGATTATAATCCCCAAGGGGACCAGGTCATCAGGATGCACCAG
GTACTCAGCTACGAGACGGCGGTGCGGGCCAACAGCTCTCGGGAGTTCCG
CGAGTACGTTTCCAAGCGCACCTGTGCCTCCCTGGTGCTAACGATTGGCT
TCTTCATGCTGATAACAGGATACTTGCTCGGTAATTTTGTGGCCGAGCGC
AAGTACCACATTCGCCAGATGACGAAAGACGGCGGCAGGTCCGTGAAACT
GAGCAGCGCCGAGTATGCCAGCCTGCAGGAGCTGCAATCATATCAGAAGG
CCAAGGATCAGCTGTTGCTGGCCGCCCAGGAGCTGGACAAGCTGCAGCAG
CAGGACGAGAGCGAGCGGTATCTGGCCACGTCGCTGAACACGGAGATCTT
CAACAGGTACATATCCTGCACGCAGGATATACCGCCCAACACGAACATTG
CGGCCAGTCAGTTCACGGAACAGCTGATCGACAACACGGTGGCCAGGCAG
CGCCACTGCTTGATGATCATCCAGCGGGTCATCGACAACCACCTGGCCAA
CAGCCAGCTCTAGAGCTCTAGGGCGGATGCCAGCGATGGTTTAGCGGGCC
AATGTTCGACATTTGACATTTATGTGTGTATGTGCTTTTAGGTGTGCTCA
ATGTGTGTGCTCCCAGCTAATTAGAAATTAGGTTTTGTAATTCATTGTGA
AAGTATTAGATCACACAAGTTTTTTATACATGTCTGCATTAAAAGTTAAA
CTTTAAAAAAAAAAAAAAA

RH37294.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15522-RA 1222 CG15522-RA 121..1222 3..1104 5510 100 Plus
CG15522.b 1364 CG15522.b 526..1364 266..1104 4195 100 Plus
CG15522.c 1114 CG15522.c 276..1114 266..1104 4195 100 Plus
CG15522.b 1364 CG15522.b 1..247 21..267 1235 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25750603..25751196 516..1104 2815 98.7 Plus
chr3R 27901430 chr3R 25749679..25749943 3..267 1295 99.2 Plus
chr3R 27901430 chr3R 25750295..25750547 267..519 1235 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29928178..29928769 516..1107 2960 100 Plus
3R 32079331 3R 29927254..29927518 3..267 1325 100 Plus
3R 32079331 3R 29927870..29928122 267..519 1265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29669009..29669600 516..1107 2960 100 Plus
3R 31820162 3R 29668085..29668349 3..267 1325 100 Plus
3R 31820162 3R 29668701..29668953 267..519 1265 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:34:58 has no hits.

RH37294.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:35:55 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25749677..25749942 1..266 98 -> Plus
chr3R 25750295..25750546 267..518 99 -> Plus
chr3R 25750606..25751196 519..1104 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:41 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 1..522 392..913 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:45 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 1..522 392..913 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:14:20 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 1..522 392..913 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:25 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 1..522 392..913 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:45:03 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 1..522 392..913 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:52 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 3..1104 3..1104 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:45 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 3..1104 3..1104 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:14:20 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 1..1101 4..1104 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:25 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 3..1104 3..1104 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:45:03 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
CG15522-RA 1..1101 4..1104 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:35:55 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29927252..29927517 1..266 99 -> Plus
3R 29927870..29928121 267..518 100 -> Plus
3R 29928181..29928766 519..1104 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:35:55 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29927252..29927517 1..266 99 -> Plus
3R 29927870..29928121 267..518 100 -> Plus
3R 29928181..29928766 519..1104 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:35:55 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29927252..29927517 1..266 99 -> Plus
3R 29927870..29928121 267..518 100 -> Plus
3R 29928181..29928766 519..1104 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:14:20 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25752974..25753239 1..266 99 -> Plus
arm_3R 25753592..25753843 267..518 100 -> Plus
arm_3R 25753903..25754488 519..1104 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:52 Download gff for RH37294.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29668083..29668348 1..266 99 -> Plus
3R 29668701..29668952 267..518 100 -> Plus
3R 29669012..29669597 519..1104 100   Plus

RH37294.pep Sequence

Translation from 391 to 912

> RH37294.pep
MHQVLSYETAVRANSSREFREYVSKRTCASLVLTIGFFMLITGYLLGNFV
AERKYHIRQMTKDGGRSVKLSSAEYASLQELQSYQKAKDQLLLAAQELDK
LQQQDESERYLATSLNTEIFNRYISCTQDIPPNTNIAASQFTEQLIDNTV
ARQRHCLMIIQRVIDNHLANSQL*

RH37294.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18807-PA 179 GF18807-PA 1..179 1..173 774 82.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11710-PA 173 GG11710-PA 1..173 1..173 894 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16773-PA 193 GH16773-PA 1..193 1..173 714 73.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15522-PB 173 CG15522-PB 1..173 1..173 868 100 Plus
CG15522-PA 173 CG15522-PA 1..173 1..173 868 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22309-PA 183 GI22309-PA 1..183 1..173 706 74.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14006-PA 179 GL14006-PA 1..179 1..173 759 80.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13780-PA 179 GA13780-PA 1..179 1..173 761 80.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12840-PA 173 GM12840-PA 1..173 1..173 906 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21483-PA 173 GD21483-PA 1..173 1..173 906 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10496-PA 188 GJ10496-PA 1..188 1..173 699 74.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13196-PA 186 GK13196-PA 1..186 1..173 694 72 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11231-PA 107 GE11231-PA 1..107 60..173 508 88.6 Plus

RH37294.hyp Sequence

Translation from 391 to 912

> RH37294.hyp
MHQVLSYETAVRANSSREFREYVSKRTCASLVLTIGFFMLITGYLLGNFV
AERKYHIRQMTKDGGRSVKLSSAEYASLQELQSYQKAKDQLLLAAQELDK
LQQQDESERYLATSLNTEIFNRYISCTQDIPPNTNIAASQFTEQLIDNTV
ARQRHCLMIIQRVIDNHLANSQL*

RH37294.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15522-PB 173 CG15522-PB 1..173 1..173 868 100 Plus
CG15522-PA 173 CG15522-PA 1..173 1..173 868 100 Plus