Clone RH37427 Report

Search the DGRC for RH37427

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:374
Well:27
Vector:pFlc-1
Associated Gene/TranscriptTrs33-RA
Protein status:RH37427.pep: gold
Preliminary Size:459
Sequenced Size:628

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6196 2001-12-17 Blastp of sequenced clone
CG6196 2002-01-01 Sim4 clustering to Release 2
CG6196 2003-01-01 Sim4 clustering to Release 3
CG6196 2008-04-29 Release 5.5 accounting
CG6196 2008-08-15 Release 5.9 accounting
CG6196 2008-12-18 5.12 accounting

Clone Sequence Records

RH37427.complete Sequence

628 bp (628 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071721

> RH37427.complete
GATTCGCCCGTTAACGCTTGCAACAGCTGTTTAAATCTAGATCAAAACAA
ATCCGAGGAAAAATTTGTTGAACTCACAAAGAAAAATTAAATCCTCGAAA
ATGTCTGAAGAAATCCTTTTCGATTGCCTCCATGCAGAGATAGTCAATTA
TTGTCTGGATAGCAATAAGGAGCACGACCTGGCCACTTTGGAGTATATAG
GCTTCACCACCGGCTACCGCCTGATTGAGCGGCTCACCCGTGAAGTTTCG
CGTTTTAAGGACGAGTTGGAGACTATGAAGTTTATATGCACCGACTTCTG
GATGCTTATATACAAGAAGCAAGTGGACAACCTGAGGACGAACAACCACG
GAATGTACGTTGTGCAGGACAAGGCTTTCCGCTTTCTGACTCGCATCTCG
CCGGGCACCAAGCAGCTGGAGCACGCGCCCAAGTTCGTGGCCTTCACGTG
CGGGCTGGTGCGAGGAGCTCTCAGCAATCTAGGCATTAACAGCACCGTGA
CGGCCGAAGTGCAAAGCATACCCGCCTGCAAGTTTCACATAGAAGTGAAC
AGGAACTAATTAGGATGTAAGGCAATGGTTTATTACTACAATTATAGAGA
TACTACAGAAAAGAAAAAAAAAAAAAAA

RH37427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG6196-RA 636 CG6196-RA 24..631 2..609 3040 100 Plus
CG31392.a 2285 CG31392.a 2238..2285 609..562 240 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11174979..11175420 609..168 2210 100 Minus
chr3R 27901430 chr3R 11175486..11175654 170..2 845 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15350344..15350785 609..168 2210 100 Minus
3R 32079331 3R 15350851..15351019 170..2 845 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15091175..15091616 609..168 2210 100 Minus
3R 31820162 3R 15091682..15091850 170..2 845 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:33:28 has no hits.

RH37427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:34:22 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11174975..11175418 170..613 99 <- Minus
chr3R 11175487..11175654 1..169 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:42 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
CG6196-RA 1..459 101..559 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:03:09 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
CG6196-RA 1..459 101..559 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:15:35 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
CG6196-RA 1..459 101..559 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:53:27 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
CG6196-RA 1..459 101..559 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:23:57 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
Trs33-RA 1..459 101..559 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:21:36 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
CG6196-RA 1..612 2..613 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:03:09 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
CG6196-RA 1..607 2..608 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:15:35 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
CG6196-RA 1..583 26..608 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:53:27 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
CG6196-RA 1..612 2..613 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:23:57 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
Trs33-RA 1..583 26..608 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:22 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15350852..15351019 1..169 99   Minus
3R 15350340..15350783 170..613 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:22 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15350852..15351019 1..169 99   Minus
3R 15350340..15350783 170..613 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:22 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15350852..15351019 1..169 99   Minus
3R 15350340..15350783 170..613 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:15:35 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11176574..11176741 1..169 99   Minus
arm_3R 11176062..11176505 170..613 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:25:35 Download gff for RH37427.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15091171..15091614 170..613 99 <- Minus
3R 15091683..15091850 1..169 99   Minus

RH37427.pep Sequence

Translation from 100 to 558

> RH37427.pep
MSEEILFDCLHAEIVNYCLDSNKEHDLATLEYIGFTTGYRLIERLTREVS
RFKDELETMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRIS
PGTKQLEHAPKFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEVN
RN*

RH37427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23236-PA 152 GF23236-PA 1..152 1..152 796 97.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20640-PA 152 GG20640-PA 1..152 1..152 819 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16884-PA 153 GH16884-PA 1..153 1..152 729 87.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
Trs33-PA 152 CG6196-PA 1..152 1..152 800 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10729-PA 153 GI10729-PA 1..152 1..151 736 89.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13756-PA 152 GL13756-PA 1..152 1..152 805 98 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19431-PA 152 GA19431-PA 1..152 1..152 805 98 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25781-PA 152 GM25781-PA 1..152 1..152 815 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20358-PA 152 GD20358-PA 1..152 1..152 819 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10671-PA 153 GJ10671-PA 1..153 1..152 753 90.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11311-PA 153 GK11311-PA 1..153 1..152 766 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26386-PA 152 GE26386-PA 1..152 1..152 819 100 Plus

RH37427.hyp Sequence

Translation from 100 to 558

> RH37427.hyp
MSEEILFDCLHAEIVNYCLDSNKEHDLATLEYIGFTTGYRLIERLTREVS
RFKDELETMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRIS
PGTKQLEHAPKFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEVN
RN*

RH37427.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Trs33-PA 152 CG6196-PA 1..152 1..152 800 100 Plus