Clone RH37844 Report

Search the DGRC for RH37844

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:378
Well:44
Vector:pFlc-1
Associated Gene/TranscriptCG17298-RA
Protein status:RH37844.pep: gold
Preliminary Size:288
Sequenced Size:511

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17298 2001-12-13 Blastp of sequenced clone
CG17298 2002-01-01 Sim4 clustering to Release 2
CG17298 2003-01-01 Sim4 clustering to Release 3
CG17298 2008-04-29 Release 5.5 accounting
CG17298 2008-08-15 Release 5.9 accounting
CG17298 2008-12-18 5.12 accounting

Clone Sequence Records

RH37844.complete Sequence

511 bp (511 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070701

> RH37844.complete
GACCAGTTGACAATTTGAAATCATTAGCCTAGCTACCTTTCCTACTTCAG
TTATCCCGCCAAAATCCAACGCCTCAAAATGTTCAAAGTACTGTTCGTGC
TCGCCGCCTTCGTCGCCTCTCAGGCTATCGCCCATCCCGGCGTGGTGGCC
GTGGCACCCGTGGTGGCGCACCCGGCGGTGGTCCACACGCCCATCATCCA
TCATGGAGCCCACTCGGTGCACTCCCATGTTGTTCATCATCCGGCAGCCG
TCAAGGTCATCACACCCGTCGTCCACAAGCCCGTGGTGGCGGTGCATGCT
GTCAGGCCGGTGGTTCCATTGGTTCCAGTGCATCATGCCGCCCCCGCCGT
CGTCGTGCATCATTAAGTGCAGCGAATACGGTTCACTTTCAATACCTTTC
CCGCTCCCGATCCCGTTCCCGATCCCCACCAGACCCAGACCAATCCCTTC
CTGAGCACCATAACCACGATCCCACAATAAAAGTTCATAGCCACGAAAAA
AAAAAAAAAAA

RH37844.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-RA 562 CG17298-RA 67..560 2..495 2470 100 Plus
CG17298.a 725 CG17298.a 230..723 2..495 2470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17107592..17107862 225..495 1355 100 Plus
chr3R 27901430 chr3R 17107396..17107529 91..224 670 100 Plus
chr3R 27901430 chr3R 17107032..17107120 2..90 415 97.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21283780..21284050 225..495 1355 100 Plus
3R 32079331 3R 21283584..21283717 91..224 670 100 Plus
3R 32079331 3R 21283198..21283286 2..90 445 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21024611..21024881 225..495 1355 100 Plus
3R 31820162 3R 21024415..21024548 91..224 670 100 Plus
3R 31820162 3R 21024029..21024117 2..90 445 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:35:08 has no hits.

RH37844.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:36:02 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17107031..17107120 1..90 96 -> Plus
chr3R 17107396..17107529 91..224 100 -> Plus
chr3R 17107592..17107862 225..495 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:45 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 1..288 79..366 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:39:57 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 1..288 79..366 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:14:30 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 1..288 79..366 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:33 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 1..288 79..366 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:45:11 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 1..288 79..366 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:14 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 2..495 2..495 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:39:57 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 2..495 2..495 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:14:30 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 2..495 2..495 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:34 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 2..495 2..495 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:45:11 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 2..495 2..495 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:02 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21283197..21283286 1..90 98 -> Plus
3R 21283584..21283717 91..224 100 -> Plus
3R 21283780..21284050 225..495 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:02 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21283197..21283286 1..90 98 -> Plus
3R 21283584..21283717 91..224 100 -> Plus
3R 21283780..21284050 225..495 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:02 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21283197..21283286 1..90 98 -> Plus
3R 21283584..21283717 91..224 100 -> Plus
3R 21283780..21284050 225..495 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:14:30 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17108919..17109008 1..90 98 -> Plus
arm_3R 17109306..17109439 91..224 100 -> Plus
arm_3R 17109502..17109772 225..495 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:34 Download gff for RH37844.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21024611..21024881 225..495 100   Plus
3R 21024028..21024117 1..90 98 -> Plus
3R 21024415..21024548 91..224 100 -> Plus

RH37844.pep Sequence

Translation from 78 to 365

> RH37844.pep
MFKVLFVLAAFVASQAIAHPGVVAVAPVVAHPAVVHTPIIHHGAHSVHSH
VVHHPAAVKVITPVVHKPVVAVHAVRPVVPLVPVHHAAPAVVVHH*

RH37844.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17703-PA 95 GF17703-PA 37..95 37..95 178 93.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24531-PA 95 GG24531-PA 1..95 1..95 386 97.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-PA 95 CG17298-PA 1..95 1..95 495 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27330-PA 101 GL27330-PA 1..101 1..95 153 77.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27036-PA 101 GA27036-PA 1..101 1..95 153 77.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15084-PA 95 GM15084-PA 1..95 1..95 390 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19413-PA 95 GD19413-PA 1..95 1..95 390 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14303-PA 101 GJ14303-PA 1..101 1..95 137 83.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25725-PA 95 GE25725-PA 1..95 1..95 385 97.9 Plus

RH37844.hyp Sequence

Translation from 78 to 365

> RH37844.hyp
MFKVLFVLAAFVASQAIAHPGVVAVAPVVAHPAVVHTPIIHHGAHSVHSH
VVHHPAAVKVITPVVHKPVVAVHAVRPVVPLVPVHHAAPAVVVHH*

RH37844.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-PA 95 CG17298-PA 1..95 1..95 495 100 Plus