RH37844.complete Sequence
511 bp (511 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070701
> RH37844.complete
GACCAGTTGACAATTTGAAATCATTAGCCTAGCTACCTTTCCTACTTCAG
TTATCCCGCCAAAATCCAACGCCTCAAAATGTTCAAAGTACTGTTCGTGC
TCGCCGCCTTCGTCGCCTCTCAGGCTATCGCCCATCCCGGCGTGGTGGCC
GTGGCACCCGTGGTGGCGCACCCGGCGGTGGTCCACACGCCCATCATCCA
TCATGGAGCCCACTCGGTGCACTCCCATGTTGTTCATCATCCGGCAGCCG
TCAAGGTCATCACACCCGTCGTCCACAAGCCCGTGGTGGCGGTGCATGCT
GTCAGGCCGGTGGTTCCATTGGTTCCAGTGCATCATGCCGCCCCCGCCGT
CGTCGTGCATCATTAAGTGCAGCGAATACGGTTCACTTTCAATACCTTTC
CCGCTCCCGATCCCGTTCCCGATCCCCACCAGACCCAGACCAATCCCTTC
CTGAGCACCATAACCACGATCCCACAATAAAAGTTCATAGCCACGAAAAA
AAAAAAAAAAA
RH37844.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:22:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17298-RA | 562 | CG17298-RA | 67..560 | 2..495 | 2470 | 100 | Plus |
CG17298.a | 725 | CG17298.a | 230..723 | 2..495 | 2470 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:35:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 17107592..17107862 | 225..495 | 1355 | 100 | Plus |
chr3R | 27901430 | chr3R | 17107396..17107529 | 91..224 | 670 | 100 | Plus |
chr3R | 27901430 | chr3R | 17107032..17107120 | 2..90 | 415 | 97.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:35:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 21283780..21284050 | 225..495 | 1355 | 100 | Plus |
3R | 32079331 | 3R | 21283584..21283717 | 91..224 | 670 | 100 | Plus |
3R | 32079331 | 3R | 21283198..21283286 | 2..90 | 445 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 21024611..21024881 | 225..495 | 1355 | 100 | Plus |
3R | 31820162 | 3R | 21024415..21024548 | 91..224 | 670 | 100 | Plus |
3R | 31820162 | 3R | 21024029..21024117 | 2..90 | 445 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 15:35:08 has no hits.
RH37844.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:36:02 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 17107031..17107120 | 1..90 | 96 | -> | Plus |
chr3R | 17107396..17107529 | 91..224 | 100 | -> | Plus |
chr3R | 17107592..17107862 | 225..495 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:45 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 1..288 | 79..366 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:39:57 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 1..288 | 79..366 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:14:30 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 1..288 | 79..366 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:33 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 1..288 | 79..366 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:45:11 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 1..288 | 79..366 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:14 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 2..495 | 2..495 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:39:57 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 2..495 | 2..495 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:14:30 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 2..495 | 2..495 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:34 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 2..495 | 2..495 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:45:11 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17298-RA | 2..495 | 2..495 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:02 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 21283197..21283286 | 1..90 | 98 | -> | Plus |
3R | 21283584..21283717 | 91..224 | 100 | -> | Plus |
3R | 21283780..21284050 | 225..495 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:02 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 21283197..21283286 | 1..90 | 98 | -> | Plus |
3R | 21283584..21283717 | 91..224 | 100 | -> | Plus |
3R | 21283780..21284050 | 225..495 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:02 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 21283197..21283286 | 1..90 | 98 | -> | Plus |
3R | 21283584..21283717 | 91..224 | 100 | -> | Plus |
3R | 21283780..21284050 | 225..495 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:14:30 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 17108919..17109008 | 1..90 | 98 | -> | Plus |
arm_3R | 17109306..17109439 | 91..224 | 100 | -> | Plus |
arm_3R | 17109502..17109772 | 225..495 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:34 Download gff for
RH37844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 21024611..21024881 | 225..495 | 100 | | Plus |
3R | 21024028..21024117 | 1..90 | 98 | -> | Plus |
3R | 21024415..21024548 | 91..224 | 100 | -> | Plus |
RH37844.pep Sequence
Translation from 78 to 365
> RH37844.pep
MFKVLFVLAAFVASQAIAHPGVVAVAPVVAHPAVVHTPIIHHGAHSVHSH
VVHHPAAVKVITPVVHKPVVAVHAVRPVVPLVPVHHAAPAVVVHH*
RH37844.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:27:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17703-PA | 95 | GF17703-PA | 37..95 | 37..95 | 178 | 93.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:27:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24531-PA | 95 | GG24531-PA | 1..95 | 1..95 | 386 | 97.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17298-PA | 95 | CG17298-PA | 1..95 | 1..95 | 495 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:27:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL27330-PA | 101 | GL27330-PA | 1..101 | 1..95 | 153 | 77.2 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:27:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA27036-PA | 101 | GA27036-PA | 1..101 | 1..95 | 153 | 77.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:27:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15084-PA | 95 | GM15084-PA | 1..95 | 1..95 | 390 | 97.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:27:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19413-PA | 95 | GD19413-PA | 1..95 | 1..95 | 390 | 97.9 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:27:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ14303-PA | 101 | GJ14303-PA | 1..101 | 1..95 | 137 | 83.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:27:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25725-PA | 95 | GE25725-PA | 1..95 | 1..95 | 385 | 97.9 | Plus |
RH37844.hyp Sequence
Translation from 78 to 365
> RH37844.hyp
MFKVLFVLAAFVASQAIAHPGVVAVAPVVAHPAVVHTPIIHHGAHSVHSH
VVHHPAAVKVITPVVHKPVVAVHAVRPVVPLVPVHHAAPAVVVHH*
RH37844.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:15:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17298-PA | 95 | CG17298-PA | 1..95 | 1..95 | 495 | 100 | Plus |