Clone RH38110 Report

Search the DGRC for RH38110

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:381
Well:10
Vector:pFlc-1
Associated Gene/TranscriptDiedel-RA
Protein status:RH38110.pep: gold
Preliminary Size:348
Sequenced Size:431

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11501 2002-01-01 Sim4 clustering to Release 2
CG11501 2003-01-01 Sim4 clustering to Release 3
CG11501 2008-04-29 Release 5.5 accounting
CG11501 2008-08-15 Release 5.9 accounting
CG11501 2008-12-18 5.12 accounting

Clone Sequence Records

RH38110.complete Sequence

431 bp (431 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070703

> RH38110.complete
GATTAGTTCTCCCAGTAAATCCAATCATGGCATCCCCAGTAGTCAGCCTG
CTTCTCGTCGGGATCTGCGCCCTGGCCTTTGTCCATGTGGCTCGGTCGGA
ATGCTGCACCTCCCGGGAGCTGGTGGAATTCAAGATGGACAGAGGCGACT
GCGAGGCTGTGCGTGCAATCGAAAACTATCCCAACGGCTGCGAAGTGACG
ATCTGCGCCGATGGTGTTGCCCAGTTGGGCGCCTACTGCGGCCAGGGATC
GTGCAACATCTTCGGCTGCAACTGCGACGGCGGCTGTCTGAGCGGCGATT
GGTCACAGGAATTTGTGAGGAGGAACCAGCAGTACGGAATCCAGATCATC
AAAGTCACCAGGCTGCCATTTTAACCCCTTGCATCACATAAACAATAAAG
AGAAGCTTTAATTGCAAAAAAAAAAAAAAAA

RH38110.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG11501-RA 416 CG11501-RA 3..416 2..415 2070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:58:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25316490..25316903 2..415 2055 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29493854..29494268 2..416 2075 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29234685..29235099 2..416 2075 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:58:01 has no hits.

RH38110.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:58:45 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25316488..25316903 1..415 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:48 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
CG11501-RA 1..348 27..374 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:52 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
CG11501-RA 1..348 27..374 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:30 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel-RA 1..348 27..374 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:59 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
CG11501-RA 1..348 27..374 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:48:08 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel-RA 1..348 27..374 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:21 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
CG11501-RA 1..414 1..413 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:52 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
CG11501-RA 1..414 1..413 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:30 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel-RA 1..416 1..415 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:59 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
CG11501-RA 1..414 1..413 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:48:08 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel-RA 1..416 1..415 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:45 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29493852..29494267 1..415 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:45 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29493852..29494267 1..415 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:45 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29493852..29494267 1..415 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:30 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25319574..25319989 1..415 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:06 Download gff for RH38110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29234683..29235098 1..415 99   Plus

RH38110.hyp Sequence

Translation from 0 to 390

> RH38110.hyp
ISSPSKSNHGIPSSQPASRRDLRPGLCPCGSVGMLHLPGAGGIQDGQRRL
RGCACNRKLSQRLRSDDLRRWCCPVGRLLRPGIVQHLRLQLRRRLSERRL
VTGICEEEPAVRNPDHQSHQAAILTPCIT*
Sequence RH38110.hyp has no blast hits.

RH38110.pep Sequence

Translation from 26 to 373

> RH38110.pep
MASPVVSLLLVGICALAFVHVARSECCTSRELVEFKMDRGDCEAVRAIEN
YPNGCEVTICADGVAQLGAYCGQGSCNIFGCNCDGGCLSGDWSQEFVRRN
QQYGIQIIKVTRLPF*

RH38110.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15937-PA 113 GF15937-PA 1..111 1..112 249 41.1 Plus
Dana\GF15938-PA 113 GF15938-PA 1..113 1..114 248 41.2 Plus
Dana\GF16013-PA 109 GF16013-PA 12..109 7..108 183 43.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11665-PA 115 GG11665-PA 1..115 1..115 464 74.8 Plus
Dere\GG19205-PA 121 GG19205-PA 1..109 1..110 216 39.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel-PA 115 CG11501-PA 1..115 1..115 625 100 Plus
Diedel2-PA 125 CG43228-PA 4..106 9..112 228 39.4 Plus
Diedel3-PB 121 CG34329-PB 1..107 1..108 225 40.7 Plus
Diedel3-PA 121 CG34329-PA 1..107 1..108 225 40.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24242-PA 113 GI24242-PA 1..108 1..108 258 42.6 Plus
Dmoj\GI11819-PA 140 GI11819-PA 24..112 22..110 201 40.4 Plus
Dmoj\GI24243-PA 112 GI24243-PA 16..94 18..96 174 39.2 Plus
Dmoj\GI22343-PA 117 GI22343-PA 27..116 22..110 152 40 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12788-PA 116 GM12788-PA 4..116 3..115 514 85 Plus
Dsec\GM12796-PA 125 GM12796-PA 4..106 9..112 207 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21438-PA 116 GD21438-PA 1..116 1..115 525 86.2 Plus
Dsim\GD17420-PA 121 GD17420-PA 1..109 1..110 218 40.9 Plus
Dsim\GD21443-PA 125 GD21443-PA 4..106 9..112 208 40.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11856-PA 131 GJ11856-PA 15..102 21..108 204 40.9 Plus
Dvir\GJ11855-PA 131 GJ11855-PA 15..102 21..108 204 40.9 Plus
Dvir\GJ14220-PA 113 GJ14220-PA 26..112 25..110 153 39.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18957-PA 113 GK18957-PA 6..101 8..100 137 35.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23854-PA 115 GE23854-PA 1..115 1..115 438 67.8 Plus
Dyak\GE23853-PA 114 GE23853-PA 1..114 1..115 432 70.4 Plus
Dyak\GE17767-PA 121 GE17767-PA 17..109 17..110 225 46.8 Plus
Dyak\GE23861-PA 125 GE23861-PA 4..102 9..108 211 40 Plus