RH38110.complete Sequence
431 bp (431 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070703
> RH38110.complete
GATTAGTTCTCCCAGTAAATCCAATCATGGCATCCCCAGTAGTCAGCCTG
CTTCTCGTCGGGATCTGCGCCCTGGCCTTTGTCCATGTGGCTCGGTCGGA
ATGCTGCACCTCCCGGGAGCTGGTGGAATTCAAGATGGACAGAGGCGACT
GCGAGGCTGTGCGTGCAATCGAAAACTATCCCAACGGCTGCGAAGTGACG
ATCTGCGCCGATGGTGTTGCCCAGTTGGGCGCCTACTGCGGCCAGGGATC
GTGCAACATCTTCGGCTGCAACTGCGACGGCGGCTGTCTGAGCGGCGATT
GGTCACAGGAATTTGTGAGGAGGAACCAGCAGTACGGAATCCAGATCATC
AAAGTCACCAGGCTGCCATTTTAACCCCTTGCATCACATAAACAATAAAG
AGAAGCTTTAATTGCAAAAAAAAAAAAAAAA
RH38110.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:48:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11501-RA | 416 | CG11501-RA | 3..416 | 2..415 | 2070 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:58:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 25316490..25316903 | 2..415 | 2055 | 99.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 29493854..29494268 | 2..416 | 2075 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 29234685..29235099 | 2..416 | 2075 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 19:58:01 has no hits.
RH38110.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:58:45 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 25316488..25316903 | 1..415 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:48 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11501-RA | 1..348 | 27..374 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:52 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11501-RA | 1..348 | 27..374 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:30 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Diedel-RA | 1..348 | 27..374 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:59 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11501-RA | 1..348 | 27..374 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:48:08 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Diedel-RA | 1..348 | 27..374 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:21 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11501-RA | 1..414 | 1..413 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:52 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11501-RA | 1..414 | 1..413 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:30 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Diedel-RA | 1..416 | 1..415 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:59 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11501-RA | 1..414 | 1..413 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:48:08 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Diedel-RA | 1..416 | 1..415 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:45 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29493852..29494267 | 1..415 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:45 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29493852..29494267 | 1..415 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:45 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29493852..29494267 | 1..415 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:30 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25319574..25319989 | 1..415 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:06 Download gff for
RH38110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29234683..29235098 | 1..415 | 99 | | Plus |
RH38110.hyp Sequence
Translation from 0 to 390
> RH38110.hyp
ISSPSKSNHGIPSSQPASRRDLRPGLCPCGSVGMLHLPGAGGIQDGQRRL
RGCACNRKLSQRLRSDDLRRWCCPVGRLLRPGIVQHLRLQLRRRLSERRL
VTGICEEEPAVRNPDHQSHQAAILTPCIT*
Sequence RH38110.hyp has no blast hits.
RH38110.pep Sequence
Translation from 26 to 373
> RH38110.pep
MASPVVSLLLVGICALAFVHVARSECCTSRELVEFKMDRGDCEAVRAIEN
YPNGCEVTICADGVAQLGAYCGQGSCNIFGCNCDGGCLSGDWSQEFVRRN
QQYGIQIIKVTRLPF*
RH38110.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:34:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15937-PA | 113 | GF15937-PA | 1..111 | 1..112 | 249 | 41.1 | Plus |
Dana\GF15938-PA | 113 | GF15938-PA | 1..113 | 1..114 | 248 | 41.2 | Plus |
Dana\GF16013-PA | 109 | GF16013-PA | 12..109 | 7..108 | 183 | 43.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:34:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG11665-PA | 115 | GG11665-PA | 1..115 | 1..115 | 464 | 74.8 | Plus |
Dere\GG19205-PA | 121 | GG19205-PA | 1..109 | 1..110 | 216 | 39.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Diedel-PA | 115 | CG11501-PA | 1..115 | 1..115 | 625 | 100 | Plus |
Diedel2-PA | 125 | CG43228-PA | 4..106 | 9..112 | 228 | 39.4 | Plus |
Diedel3-PB | 121 | CG34329-PB | 1..107 | 1..108 | 225 | 40.7 | Plus |
Diedel3-PA | 121 | CG34329-PA | 1..107 | 1..108 | 225 | 40.7 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:34:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI24242-PA | 113 | GI24242-PA | 1..108 | 1..108 | 258 | 42.6 | Plus |
Dmoj\GI11819-PA | 140 | GI11819-PA | 24..112 | 22..110 | 201 | 40.4 | Plus |
Dmoj\GI24243-PA | 112 | GI24243-PA | 16..94 | 18..96 | 174 | 39.2 | Plus |
Dmoj\GI22343-PA | 117 | GI22343-PA | 27..116 | 22..110 | 152 | 40 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:34:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM12788-PA | 116 | GM12788-PA | 4..116 | 3..115 | 514 | 85 | Plus |
Dsec\GM12796-PA | 125 | GM12796-PA | 4..106 | 9..112 | 207 | 37.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:34:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21438-PA | 116 | GD21438-PA | 1..116 | 1..115 | 525 | 86.2 | Plus |
Dsim\GD17420-PA | 121 | GD17420-PA | 1..109 | 1..110 | 218 | 40.9 | Plus |
Dsim\GD21443-PA | 125 | GD21443-PA | 4..106 | 9..112 | 208 | 40.4 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:34:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11856-PA | 131 | GJ11856-PA | 15..102 | 21..108 | 204 | 40.9 | Plus |
Dvir\GJ11855-PA | 131 | GJ11855-PA | 15..102 | 21..108 | 204 | 40.9 | Plus |
Dvir\GJ14220-PA | 113 | GJ14220-PA | 26..112 | 25..110 | 153 | 39.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:34:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK18957-PA | 113 | GK18957-PA | 6..101 | 8..100 | 137 | 35.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:34:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23854-PA | 115 | GE23854-PA | 1..115 | 1..115 | 438 | 67.8 | Plus |
Dyak\GE23853-PA | 114 | GE23853-PA | 1..114 | 1..115 | 432 | 70.4 | Plus |
Dyak\GE17767-PA | 121 | GE17767-PA | 17..109 | 17..110 | 225 | 46.8 | Plus |
Dyak\GE23861-PA | 125 | GE23861-PA | 4..102 | 9..108 | 211 | 40 | Plus |