Clone RH38235 Report

Search the DGRC for RH38235

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:382
Well:35
Vector:pFlc-1
Associated Gene/TranscriptCG9812-RB
Protein status:RH38235.pep: validated full length
Preliminary Size:1484
Sequenced Size:1315

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9812 2002-01-01 Sim4 clustering to Release 2
CG9812 2002-03-20 Blastp of sequenced clone
CG9812 2003-01-01 Sim4 clustering to Release 3
CG9812 2008-04-29 Release 5.5 accounting
CG9812 2008-08-15 Release 5.9 accounting
CG9812 2008-12-18 5.12 accounting

Clone Sequence Records

RH38235.complete Sequence

1315 bp (1315 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094922

> RH38235.complete
GACATTTCCAGTTTAGCCAGGCATTACAAGCACCAGAAATTTCCCACTCC
CCGCGGCAGAATTCAAGTTTAAGCCCGGCTCAAGCCACTCGACCACTCAG
TTCACAGCGGAATCGCGTCGCGTCAACAACGTACAGCTCAGACTCAAACT
CAGACTCAGACTCGCGAAGTGAAATAATTTAAAACAATAACAACGAAAAG
CGTCTAGGAAAGGTGCGCAGTATGTTCGTCTTACTCGGAGCACTCTGTCT
GCTGCAGACGGCTAGCTTGGTGCCGGCACAGCTGTTTACTTTCCGCGATG
GCAAGGTGGGCGTGAACTTCGCAGGATATCACGCAGATGCGGGACTCGGC
GGACTCCTTACGGGCAACTCTGCCCACGGCGGACTCAGCGCCTCGGCCGG
AACACCTTGGGGCTCCCGGGCAGCCGCCGGTCTGGGCGGCAATCTGGATG
GACGCACAGCCGGCGTGGGATACGCCGCCGCCCAGGCCAATCCCTCGGTG
GGAGCCAGTGCGCTTCTGGGCGGCAGCGCCGGTGAACATGGTTATATCGG
AGCCGAGGCGCACAGTCCTGGTCGCACTGTGATCTCCTCCTCGCAGCACT
CAGTCCAGCCGGCATATCCTGCTGATCCTGTGCCCGTCTCACCCACCACC
GGCCCCGTCGTCACCAGCCACATCCAAAAGGTCAAGCCGCCCAAGAAGTA
CTCGCTGATCAACCAAGATGCAAGGAGCGAGGCCAAGGTGGTCCAGGCCC
ACAAGTACAAGTCCGTCCAGCGACCCCAGGCCGTGAACAATCGCTTCCTG
GCGCCCCAGGCCCAATGACCCGTGGGCCTGGCCCTCGATATTCCCATTGG
CATCCTGCGCTCCCTGAGCAATCCTTGGGCGCCCTGGGCGGTGGCGGTCA
GCAGCCAGCAGCTGCAGCTGCAGTTGCAGGTGCTCAGGCCAATGCGCACA
ACCACTAGAGATATAATTTCGAGATTCGTACGACCTCTGAAGCATCAAAG
ATACAGGAGGAATTAATAAAGCATCTGCACACTGGACAGAATAAATTCGA
TTGAGCAGAGATACATAACAGTATGATTTGCCATTAGTCATTACCCAAAA
TCAAGCTACGAGCTGAGAAAGCAAATTATTTGCTGACAACAGTGAATACA
CATATCCAAGGAATGTACCAATTCAATAAAAGTTAAATTTCATTATGACA
AATTAAGTAAGGTGCAAACCTCTAAAAAATTCACTTACATTGCTAGTCTA
CACATAACTTGTTTGATTGCCAATAAATATGATTTTTTTTTTCACTTAAA
AAAAAAAAAAAAAAA

RH38235.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9812.a 1678 CG9812.a 194..1491 2..1298 6450 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19298673..19299126 1290..840 2080 98.2 Minus
chr2R 21145070 chr2R 19300825..19301099 724..450 1300 98.2 Minus
chr2R 21145070 chr2R 19305791..19306003 214..2 1065 100 Minus
chr2R 21145070 chr2R 19301164..19301336 451..279 865 100 Minus
chr2R 21145070 chr2R 19299346..19299465 839..720 585 99.2 Minus
chr2R 21145070 chr2R 19305546..19305616 281..211 355 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23412335..23412794 1298..840 2250 99.8 Minus
2R 25286936 2R 23414492..23414766 724..450 1360 99.6 Minus
2R 25286936 2R 23419472..23419684 214..2 1065 100 Minus
2R 25286936 2R 23414831..23415003 451..279 865 100 Minus
2R 25286936 2R 23413014..23413133 839..720 600 100 Minus
2R 25286936 2R 23419227..23419297 281..211 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23413534..23413993 1298..840 2260 99.7 Minus
2R 25260384 2R 23415691..23415965 724..450 1360 99.6 Minus
2R 25260384 2R 23420671..23420883 214..2 1065 100 Minus
2R 25260384 2R 23416030..23416202 451..279 865 100 Minus
2R 25260384 2R 23414213..23414332 839..720 600 100 Minus
2R 25260384 2R 23420426..23420496 281..211 355 100 Minus
Blast to na_te.dros performed 2019-03-16 00:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 490..540 142..193 122 73.1 Plus

RH38235.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:11:43 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19305793..19306003 1..212 99   Minus
chr2R 19298668..19299126 840..1297 98 <- Minus
chr2R 19299346..19299465 720..839 99 <- Minus
chr2R 19300830..19301098 451..719 98 <- Minus
chr2R 19301165..19301333 282..450 100 <- Minus
chr2R 19305546..19305614 213..281 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:54 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..738 222..958 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:25:40 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..738 222..958 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:50:48 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..738 222..958 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:01:01 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..738 222..958 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:00:06 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..738 222..958 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:52:13 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..1297 2..1297 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:25:40 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..1297 2..1297 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:50:48 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..1297 2..1297 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:01:02 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..1297 2..1297 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:00:06 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
CG9812-RB 1..1297 2..1297 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:11:43 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23414832..23415000 282..450 100 <- Minus
2R 23419227..23419295 213..281 100 <- Minus
2R 23412336..23412794 840..1297 99 <- Minus
2R 23413014..23413133 720..839 100 <- Minus
2R 23414497..23414765 451..719 100 <- Minus
2R 23419474..23419684 1..212 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:11:43 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23414832..23415000 282..450 100 <- Minus
2R 23419227..23419295 213..281 100 <- Minus
2R 23412336..23412794 840..1297 99 <- Minus
2R 23413014..23413133 720..839 100 <- Minus
2R 23414497..23414765 451..719 100 <- Minus
2R 23419474..23419684 1..212 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:11:43 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23414832..23415000 282..450 100 <- Minus
2R 23419227..23419295 213..281 100 <- Minus
2R 23412336..23412794 840..1297 99 <- Minus
2R 23413014..23413133 720..839 100 <- Minus
2R 23414497..23414765 451..719 100 <- Minus
2R 23419474..23419684 1..212 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:50:48 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19299859..19300317 840..1297 99 <- Minus
arm_2R 19300537..19300656 720..839 100 <- Minus
arm_2R 19302020..19302288 451..719 100 <- Minus
arm_2R 19302355..19302523 282..450 100 <- Minus
arm_2R 19306750..19306818 213..281 100 <- Minus
arm_2R 19306997..19307207 1..212 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:34:12 Download gff for RH38235.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23413553..23414011 840..1297 99 <- Minus
2R 23414231..23414350 720..839 100 <- Minus
2R 23415714..23415982 451..719 100 <- Minus
2R 23416049..23416217 282..450 100 <- Minus
2R 23420444..23420512 213..281 100 <- Minus
2R 23420691..23420901 1..212 99   Minus

RH38235.pep Sequence

Translation from 221 to 817

> RH38235.pep
MFVLLGALCLLQTASLVPAQLFTFRDGKVGVNFAGYHADAGLGGLLTGNS
AHGGLSASAGTPWGSRAAAGLGGNLDGRTAGVGYAAAQANPSVGASALLG
GSAGEHGYIGAEAHSPGRTVISSSQHSVQPAYPADPVPVSPTTGPVVTSH
IQKVKPPKKYSLINQDARSEAKVVQAHKYKSVQRPQAVNNRFLAPQAQ*

RH38235.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11851-PA 328 GF11851-PA 1..177 1..177 713 80.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20033-PA 333 GG20033-PA 1..176 1..177 771 86 Plus
Dere\GG20033-PA 333 GG20033-PA 252..283 166..197 146 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20659-PA 279 GH20659-PA 1..254 1..198 508 51.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG9812-PE 245 CG9812-PE 1..198 1..198 1018 100 Plus
CG9812-PB 245 CG9812-PB 1..198 1..198 1018 100 Plus
CG9812-PD 332 CG9812-PD 1..191 1..193 873 89.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19022-PA 327 GI19022-PA 1..171 1..167 507 68.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17564-PA 275 GL17564-PA 1..235 1..197 617 59.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22052-PB 243 GA22052-PB 1..203 1..197 766 75.8 Plus
Dpse\GA22052-PA 329 GA22052-PA 1..179 1..177 679 76.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15546-PA 329 GM15546-PA 1..191 1..193 831 87.6 Plus
Dsec\GM15546-PA 329 GM15546-PA 248..280 166..198 166 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25050-PA 331 GD25050-PA 1..176 1..177 819 91 Plus
Dsim\GD25050-PA 331 GD25050-PA 250..282 166..198 166 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19988-PA 323 GJ19988-PA 38..184 20..165 473 74.1 Plus
Dvir\GJ19987-PA 171 GJ19987-PA 1..168 1..165 463 68.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23058-PA 318 GK23058-PA 1..164 1..167 610 78.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11570-PA 254 GE11570-PA 1..241 1..198 860 74.7 Plus

RH38235.hyp Sequence

Translation from 221 to 817

> RH38235.hyp
MFVLLGALCLLQTASLVPAQLFTFRDGKVGVNFAGYHADAGLGGLLTGNS
AHGGLSASAGTPWGSRAAAGLGGNLDGRTAGVGYAAAQANPSVGASALLG
GSAGEHGYIGAEAHSPGRTVISSSQHSVQPAYPADPVPVSPTTGPVVTSH
IQKVKPPKKYSLINQDARSEAKVVQAHKYKSVQRPQAVNNRFLAPQAQ*

RH38235.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9812-PE 245 CG9812-PE 1..198 1..198 1018 100 Plus
CG9812-PB 245 CG9812-PB 1..198 1..198 1018 100 Plus
CG9812-PD 332 CG9812-PD 1..191 1..193 873 89.1 Plus