Clone RH38463 Report

Search the DGRC for RH38463

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:384
Well:63
Vector:pFlc-1
Associated Gene/TranscriptCG12483-RA
Protein status:RH38463.pep: gold
Preliminary Size:183
Sequenced Size:621

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12483 2002-01-01 Sim4 clustering to Release 2
CG12483 2002-04-22 Blastp of sequenced clone
CG12483 2003-01-01 Sim4 clustering to Release 3
CG12483 2008-04-29 Release 5.5 accounting
CG12483 2008-08-15 Release 5.9 accounting
CG12483 2008-12-18 5.12 accounting

Clone Sequence Records

RH38463.complete Sequence

621 bp (621 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113585

> RH38463.complete
GATAGTTGGTTTAAACCTGCATTGGAGTGGAACTGTACTAACAATGAAAC
TGGCAATGTTGTCCTGGATTACTTGGGTGATGCTTCGGAGCATCGCAGAG
GCTCAAGTTCCAGATCAACCCGAGGCTATGGGTGCCGCCCAAGGGGGCTT
GGGCGCAGCGGCGGGGGCGGGCGGACAATTTGGAGCTCACGGCGGCGGAG
CGGCTAAAGCCGTTGAGGACGGACCTGGAGCTGGGATGGACGTCGGCATT
GGAGCGGGCGCCGAGGTGGGTGGGAGTGCTCGTGCCGGAGGCGCTGGACG
TAGACGCTAGGGACGTCTCTTATGTCAGACATTTCATAAACTTGTTTTTC
TATTTGTTCTTACACTTACACTTGTGCATTGGAAATACCTCCTAGAAGAA
GAAAGCCGACAGTACAGAGCTTTAATTAATTACCGCTGCTTTGTTAAAAA
ATGTCAAAATTTGTTTATCGCACACTCCGCACACTTGTCGGCGCCAGATT
TTTTTCCGGGAGCTCAGTGTCATAATTGATTCGAAATAGCGGTGCTCCGC
AACGTAATGGGTCACACGCACTCGACACTCACTTTAAATAAATGCGAAAC
AAATCAAAAAAAAAAAAAAAA

RH38463.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12483-RA 773 CG12483-RA 57..663 2..608 3035 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 97583..98100 605..88 2560 99.6 Minus
chr3L 24539361 chr3L 98240..98326 88..2 435 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 97625..98145 608..88 2605 100 Minus
3L 28110227 3L 98285..98371 88..2 435 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 97625..98145 608..88 2605 100 Minus
3L 28103327 3L 98285..98371 88..2 435 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:58:54 has no hits.

RH38463.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:00:00 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 97583..98099 89..605 99 <- Minus
chr3L 98240..98326 1..88 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:55 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 1..267 44..310 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:58:42 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 1..267 44..310 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:39 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 1..267 44..310 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:00 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 1..267 44..310 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:48:18 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 1..267 44..310 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:39:08 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 1..604 2..605 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:58:42 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 1..604 2..605 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:39 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 4..608 1..605 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:00 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 1..604 2..605 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:48:18 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
CG12483-RA 4..608 1..605 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:00 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
3L 97628..98144 89..605 100 <- Minus
3L 98285..98371 1..88 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:00 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
3L 97628..98144 89..605 100 <- Minus
3L 98285..98371 1..88 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:00 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
3L 97628..98144 89..605 100 <- Minus
3L 98285..98371 1..88 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:39 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 98285..98371 1..88 98   Minus
arm_3L 97628..98144 89..605 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:03 Download gff for RH38463.complete
Subject Subject Range Query Range Percent Splice Strand
3L 97628..98144 89..605 100 <- Minus
3L 98285..98371 1..88 98   Minus

RH38463.hyp Sequence

Translation from 0 to 309

> RH38463.hyp
IVGLNLHWSGTVLTMKLAMLSWITWVMLRSIAEAQVPDQPEAMGAAQGGL
GAAAGAGGQFGAHGGGAAKAVEDGPGAGMDVGIGAGAEVGGSARAGGAGR
RR*

RH38463.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12483-PA 88 CG12483-PA 1..88 15..102 452 100 Plus

RH38463.pep Sequence

Translation from 43 to 309

> RH38463.pep
MKLAMLSWITWVMLRSIAEAQVPDQPEAMGAAQGGLGAAAGAGGQFGAHG
GGAAKAVEDGPGAGMDVGIGAGAEVGGSARAGGAGRRR*

RH38463.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14688-PA 88 GG14688-PA 1..88 1..88 203 78.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG12483-PA 88 CG12483-PA 1..88 1..88 452 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13540-PA 88 GD13540-PA 1..75 1..75 179 93.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21049-PA 90 GE21049-PA 1..90 1..88 193 78.9 Plus