Clone RH39533 Report

Search the DGRC for RH39533

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:395
Well:33
Vector:pFlc-1
Associated Gene/TranscriptDbi-RA
Protein status:RH39533.pep: gold
Preliminary Size:394
Sequenced Size:428

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8627 2001-12-13 Blastp of sequenced clone
CG8627 2002-01-01 Sim4 clustering to Release 2
CG8627 2003-01-01 Sim4 clustering to Release 3
Dbi 2008-04-29 Release 5.5 accounting
Dbi 2008-08-15 Release 5.9 accounting
Dbi 2008-12-18 5.12 accounting

Clone Sequence Records

RH39533.complete Sequence

428 bp (428 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070704

> RH39533.complete
GAGACACTGTTTAGTTCTGTGGCAAACAACACACAACAATAAAATCTAAC
CCAGAATGGTTTCCGAGCAATTCAACGCCGCCGCCGAGAAGGTGAAGAGC
CTGACCAAGCGTCCCAGTGATGACGAGTTCCTGCAGCTGTACGCCCTGTT
CAAGCAGGCCAGCGTTGGTGACAACGACACCGCCAAGCCGGGTCTCCTGG
ACCTGAAGGGCAAGGCCAAGTGGGAGGCCTGGAACAAGCAGAAGGGCAAG
AGCAGCGAGGCCGCCCAGCAGGAGTACATCACCTTTGTGGAGGGCCTGGT
GGCCAAGTATGCCTAAAAACCCAATCCCAGCAATTAGCGATCTTAAACCA
GCTAGAGACTATTGTAATGTTACCTTTAATGCGGAATAAACTTCGTATGT
TAATTTTGTACTAAAAAAAAAAAAAAAA

RH39533.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dbi-RA 584 Dbi-RA 119..533 2..416 2075 100 Plus
Dbi-RB 523 Dbi-RB 103..480 39..416 1890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7125378..7125724 66..412 1720 99.7 Plus
chr3L 24539361 chr3L 7124131..7124171 2..42 190 97.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7133117..7133467 66..416 1755 100 Plus
3L 28110227 3L 7131872..7131912 2..42 190 97.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7126217..7126567 66..416 1755 100 Plus
3L 28103327 3L 7124972..7125012 2..42 190 97.5 Plus
3L 28103327 3L 7125749..7125777 39..67 145 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:28:24 has no hits.

RH39533.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:29:10 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7124130..7124167 1..38 97 -> Plus
chr3L 7124910..7124938 39..67 100 -> Plus
chr3L 7125380..7125724 68..412 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:07 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RA 1..261 56..316 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:55 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RA 1..261 56..316 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:54:19 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RB 1..261 56..316 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:01 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RA 1..261 56..316 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:28:16 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RB 1..261 56..316 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:24 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RA 2..412 2..412 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:55 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RA 7..418 1..412 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:54:19 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RA 9..420 1..412 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:01 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RA 2..412 2..412 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:28:16 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
Dbi-RA 9..420 1..412 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:29:10 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7132649..7132677 39..67 100 -> Plus
3L 7131871..7131908 1..38 97 -> Plus
3L 7133119..7133463 68..412 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:29:10 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7132649..7132677 39..67 100 -> Plus
3L 7131871..7131908 1..38 97 -> Plus
3L 7133119..7133463 68..412 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:29:10 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7132649..7132677 39..67 100 -> Plus
3L 7131871..7131908 1..38 97 -> Plus
3L 7133119..7133463 68..412 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:54:19 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7124971..7125008 1..38 97 -> Plus
arm_3L 7125749..7125777 39..67 100 -> Plus
arm_3L 7126219..7126563 68..412 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:09 Download gff for RH39533.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7126219..7126563 68..412 100   Plus
3L 7124971..7125008 1..38 97 -> Plus
3L 7125749..7125777 39..67 100 -> Plus

RH39533.hyp Sequence

Translation from 55 to 315

> RH39533.hyp
MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDL
KGKAKWEAWNKQKGKSSEAAQQEYITFVEGLVAKYA*

RH39533.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dbi-PA 86 CG8627-PA 1..86 1..86 437 100 Plus
Dbi-PB 86 CG8627-PB 1..86 1..86 437 100 Plus
CG8498-PB 90 CG8498-PB 5..84 4..83 251 58.8 Plus
CG8498-PA 90 CG8498-PA 5..84 4..83 251 58.8 Plus
CG8629-PA 84 CG8629-PA 4..84 6..86 225 53.1 Plus

RH39533.pep Sequence

Translation from 55 to 315

> RH39533.pep
MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDL
KGKAKWEAWNKQKGKSSEAAQQEYITFVEGLVAKYA*

RH39533.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25011-PA 85 GF25011-PA 1..85 2..86 401 91.8 Plus
Dana\GF14408-PA 88 GF14408-PA 1..82 2..83 246 56.1 Plus
Dana\GF24791-PA 84 GF24791-PA 1..84 1..86 227 54.7 Plus
Dana\GF25010-PA 84 GF25010-PA 1..84 1..86 214 52.3 Plus
Dana\GF14989-PA 323 GF14989-PA 5..89 2..82 154 36.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14406-PA 86 GG14406-PA 1..86 1..86 435 98.8 Plus
Dere\GG23473-PA 90 GG23473-PA 5..84 4..83 251 58.8 Plus
Dere\GG14997-PA 84 GG14997-PA 1..84 1..86 226 54.7 Plus
Dere\GG14405-PA 84 GG14405-PA 1..84 1..86 211 53.5 Plus
Dere\GG24896-PA 321 GG24896-PA 4..89 2..82 151 38.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14518-PA 87 GH14518-PA 3..87 2..86 381 82.4 Plus
Dgri\GH16140-PA 84 GH16140-PA 2..84 4..86 255 59 Plus
Dgri\GH11506-PA 90 GH11506-PA 5..84 4..83 242 57.5 Plus
Dgri\GH17042-PA 84 GH17042-PA 3..84 5..86 216 52.4 Plus
Dgri\GH16139-PA 81 GH16139-PA 3..80 6..85 152 37.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Acbp2-PA 86 CG8627-PA 1..86 1..86 437 100 Plus
Acbp2-PB 86 CG8627-PB 1..86 1..86 437 100 Plus
Acbp1-PB 90 CG8498-PB 5..84 4..83 251 58.8 Plus
Acbp1-PA 90 CG8498-PA 5..84 4..83 251 58.8 Plus
Acbp4-PA 84 CG8629-PA 4..84 6..86 225 53.1 Plus
Acbp3-PA 84 CG8628-PA 4..84 6..86 213 51.9 Plus
Acbp3-PB 84 CG8628-PB 4..84 6..86 213 51.9 Plus
CG8814-PA 324 CG8814-PA 4..89 2..82 161 39.5 Plus
Acbp5-PA 82 CG5804-PA 4..75 6..79 144 39.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13295-PA 87 GI13295-PA 3..87 2..86 390 85.9 Plus
Dmoj\GI17002-PA 90 GI17002-PA 5..84 4..83 244 57.5 Plus
Dmoj\GI11160-PA 322 GI11160-PA 4..88 2..82 162 38.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25029-PA 87 GL25029-PA 3..87 2..86 401 89.4 Plus
Dper\GL19321-PA 90 GL19321-PA 5..84 4..83 245 57.5 Plus
Dper\GL25142-PA 84 GL25142-PA 1..84 1..86 233 57 Plus
Dper\GL25027-PA 84 GL25027-PA 1..84 1..86 227 55.8 Plus
Dper\GL26292-PA 318 GL26292-PA 4..88 2..82 170 41.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21218-PA 87 GA21218-PA 3..87 2..86 404 89.4 Plus
Dpse\GA21120-PA 90 GA21120-PA 5..84 4..83 251 58.8 Plus
Dpse\GA21220-PA 84 GA21220-PA 1..84 1..86 233 57 Plus
Dpse\GA23591-PA 84 GA23591-PA 1..84 1..86 227 55.8 Plus
Dpse\GA21340-PA 318 GA21340-PA 4..88 2..82 170 41.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14822-PA 86 GM14822-PA 1..86 1..86 431 97.7 Plus
Dsec\GM13159-PA 90 GM13159-PA 5..84 4..83 251 58.8 Plus
Dsec\GM13788-PA 84 GM13788-PA 1..84 1..86 224 53.5 Plus
Dsec\GM14821-PA 84 GM14821-PA 1..84 1..86 212 53.5 Plus
Dsec\GM18376-PA 324 GM18376-PA 4..89 2..82 158 39.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13995-PA 86 GD13995-PA 1..86 1..86 435 98.8 Plus
Dsim\GD22437-PA 90 GD22437-PA 5..84 4..83 251 58.8 Plus
Dsim\GD13089-PA 84 GD13089-PA 1..84 1..86 224 53.5 Plus
Dsim\GD13994-PA 84 GD13994-PA 1..84 1..86 212 53.5 Plus
Dsim\GD23191-PA 324 GD23191-PA 4..89 2..82 157 39.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12061-PA 87 GJ12061-PA 3..87 2..86 384 85.9 Plus
Dvir\GJ12299-PA 83 GJ12299-PA 3..83 6..86 251 59.3 Plus
Dvir\GJ24270-PA 90 GJ24270-PA 5..84 4..83 241 57.5 Plus
Dvir\GJ13316-PA 84 GJ13316-PA 3..84 5..86 219 52.4 Plus
Dvir\GJ12298-PA 81 GJ12298-PA 3..74 6..79 157 40.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16653-PA 87 GK16653-PA 3..87 2..86 394 87.1 Plus
Dwil\GK19286-PA 81 GK19286-PA 1..81 6..86 261 60.5 Plus
Dwil\GK23743-PA 90 GK23743-PA 5..84 4..83 244 56.2 Plus
Dwil\GK17538-PA 84 GK17538-PA 1..84 1..86 216 52.3 Plus
Dwil\GK16652-PA 82 GK16652-PA 4..81 6..85 155 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21596-PA 86 GE21596-PA 1..86 1..86 435 98.8 Plus
Dyak\GE11169-PA 90 GE11169-PA 5..84 4..83 250 58.8 Plus
Dyak\GE20443-PA 84 GE20443-PA 3..84 5..86 219 52.4 Plus
Dyak\GE21595-PA 84 GE21595-PA 1..84 1..86 212 53.5 Plus
Dyak\GE18189-PA 323 GE18189-PA 4..89 2..82 158 39.5 Plus