BDGP Sequence Production Resources |
Search the DGRC for RH39779
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 397 |
Well: | 79 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG13315-RA |
Protein status: | RH39779.pep: gold |
Preliminary Size: | 210 |
Sequenced Size: | 513 |
Gene | Date | Evidence |
---|---|---|
CG13315 | 2002-10-18 | Blastp of sequenced clone |
CG13315 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13315 | 2008-04-29 | Release 5.5 accounting |
CG13315 | 2008-08-15 | Release 5.9 accounting |
CG13315 | 2008-12-18 | 5.12 accounting |
513 bp (513 high quality bases) assembled on 2002-10-18
GenBank Submission: BT001817
> RH39779.complete GCCAGAAACGAAACGAGCGCGCCAATGATCGTACGAATTCATTAGGAACA ACCCAGATATAGAGACGACTCTATAGCGAAAGCAACCCAACTGTGATACT AAACGAACACACACACACAACAATATCCCCAAGATGTCTGCCACTAAGGT GAACCATTTGATCGGAGCGACTACGCGCTACATTGCCGGACGGAATGCGG TGCAGACGGTCTACTGGCGCACCTCAGCCGGACCCAATCCCCGGATGCTG AAGACCAACAAGCTGCAGAACTTCGATCGCACCCAGAAGGCGCCTCAGAG TGTACGGATGCAGAACTATGATCGCAGCTATATCCGTGATTAGGGATTAG TTTTAGTTCCGGCCTTGACATGTTCCTAATGTCGCACTAGACATACATAT GTAAATTTTTTTTGTGCACTTTGTATTTATTATGCATAGAGTATTTTCCA AAACGATAGTTCTTATCGTGCAAATTAGAGTTAATCGAATCTAAACGAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13315-RA | 621 | CG13315-RA | 5..501 | 3..499 | 2485 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 9088805..9089301 | 3..497 | 2390 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 9096880..9097376 | 3..499 | 2485 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 9089980..9090476 | 3..499 | 2485 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
invader4 | 3105 | invader4 INVADER4 3105bp | 1093..1147 | 44..98 | 113 | 67.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 9088801..9089301 | 1..497 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 1..210 | 134..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 1..210 | 134..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 1..210 | 134..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 1..210 | 134..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 1..210 | 134..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 1..499 | 1..497 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 1..499 | 1..497 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 2..498 | 2..497 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 1..499 | 1..497 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13315-RA | 2..498 | 2..497 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9096876..9097374 | 1..497 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9096876..9097374 | 1..497 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9096876..9097374 | 1..497 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 9089976..9090474 | 1..497 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9089976..9090474 | 1..497 | 99 | Plus |
Translation from 133 to 342
> RH39779.hyp MSATKVNHLIGATTRYIAGRNAVQTVYWRTSAGPNPRMLKTNKLQNFDRT QKAPQSVRMQNYDRSYIRD*
Translation from 133 to 342
> RH39779.pep MSATKVNHLIGATTRYIAGRNAVQTVYWRTSAGPNPRMLKTNKLQNFDRT QKAPQSVRMQNYDRSYIRD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10856-PA | 72 | GF10856-PA | 3..68 | 2..67 | 296 | 78.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14375-PA | 69 | GG14375-PA | 1..69 | 1..69 | 356 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15578-PA | 71 | GH15578-PA | 3..68 | 2..67 | 276 | 74.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13315-PB | 69 | CG13315-PB | 1..69 | 1..69 | 361 | 100 | Plus |
CG13315-PA | 69 | CG13315-PA | 1..69 | 1..69 | 361 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16853-PA | 71 | GI16853-PA | 3..68 | 2..67 | 264 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15040-PA | 70 | GL15040-PA | 1..68 | 1..67 | 244 | 67.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12196-PA | 70 | GA12196-PA | 1..68 | 1..67 | 244 | 67.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25119-PA | 69 | GM25119-PA | 1..69 | 1..69 | 361 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14154-PA | 69 | GD14154-PA | 1..69 | 1..69 | 364 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12604-PA | 71 | GJ12604-PA | 3..68 | 2..67 | 270 | 74.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23681-PA | 71 | GK23681-PA | 3..68 | 2..67 | 289 | 78.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20806-PA | 69 | GE20806-PA | 1..69 | 1..69 | 357 | 97.1 | Plus |