Clone RH39779 Report

Search the DGRC for RH39779

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:397
Well:79
Vector:pFlc-1
Associated Gene/TranscriptCG13315-RA
Protein status:RH39779.pep: gold
Preliminary Size:210
Sequenced Size:513

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13315 2002-10-18 Blastp of sequenced clone
CG13315 2003-01-01 Sim4 clustering to Release 3
CG13315 2008-04-29 Release 5.5 accounting
CG13315 2008-08-15 Release 5.9 accounting
CG13315 2008-12-18 5.12 accounting

Clone Sequence Records

RH39779.complete Sequence

513 bp (513 high quality bases) assembled on 2002-10-18

GenBank Submission: BT001817

> RH39779.complete
GCCAGAAACGAAACGAGCGCGCCAATGATCGTACGAATTCATTAGGAACA
ACCCAGATATAGAGACGACTCTATAGCGAAAGCAACCCAACTGTGATACT
AAACGAACACACACACACAACAATATCCCCAAGATGTCTGCCACTAAGGT
GAACCATTTGATCGGAGCGACTACGCGCTACATTGCCGGACGGAATGCGG
TGCAGACGGTCTACTGGCGCACCTCAGCCGGACCCAATCCCCGGATGCTG
AAGACCAACAAGCTGCAGAACTTCGATCGCACCCAGAAGGCGCCTCAGAG
TGTACGGATGCAGAACTATGATCGCAGCTATATCCGTGATTAGGGATTAG
TTTTAGTTCCGGCCTTGACATGTTCCTAATGTCGCACTAGACATACATAT
GTAAATTTTTTTTGTGCACTTTGTATTTATTATGCATAGAGTATTTTCCA
AAACGATAGTTCTTATCGTGCAAATTAGAGTTAATCGAATCTAAACGAAA
AAAAAAAAAAAAA

RH39779.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-RA 621 CG13315-RA 5..501 3..499 2485 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9088805..9089301 3..497 2390 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9096880..9097376 3..499 2485 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9089980..9090476 3..499 2485 100 Plus
Blast to na_te.dros performed 2019-03-16 23:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
invader4 3105 invader4 INVADER4 3105bp 1093..1147 44..98 113 67.3 Plus

RH39779.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:46:38 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9088801..9089301 1..497 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:09 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 1..210 134..343 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:06 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 1..210 134..343 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:24:09 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 1..210 134..343 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:05 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 1..210 134..343 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:58:37 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 1..210 134..343 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:49 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 1..499 1..497 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:06 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 1..499 1..497 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:24:09 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 2..498 2..497 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:05 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 1..499 1..497 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:58:37 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 2..498 2..497 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:38 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9096876..9097374 1..497 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:38 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9096876..9097374 1..497 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:38 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9096876..9097374 1..497 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:24:09 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9089976..9090474 1..497 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:56 Download gff for RH39779.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9089976..9090474 1..497 99   Plus

RH39779.hyp Sequence

Translation from 133 to 342

> RH39779.hyp
MSATKVNHLIGATTRYIAGRNAVQTVYWRTSAGPNPRMLKTNKLQNFDRT
QKAPQSVRMQNYDRSYIRD*

RH39779.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-PB 69 CG13315-PB 1..69 1..69 361 100 Plus
CG13315-PA 69 CG13315-PA 1..69 1..69 361 100 Plus

RH39779.pep Sequence

Translation from 133 to 342

> RH39779.pep
MSATKVNHLIGATTRYIAGRNAVQTVYWRTSAGPNPRMLKTNKLQNFDRT
QKAPQSVRMQNYDRSYIRD*

RH39779.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10856-PA 72 GF10856-PA 3..68 2..67 296 78.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14375-PA 69 GG14375-PA 1..69 1..69 356 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15578-PA 71 GH15578-PA 3..68 2..67 276 74.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-PB 69 CG13315-PB 1..69 1..69 361 100 Plus
CG13315-PA 69 CG13315-PA 1..69 1..69 361 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16853-PA 71 GI16853-PA 3..68 2..67 264 72.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15040-PA 70 GL15040-PA 1..68 1..67 244 67.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12196-PA 70 GA12196-PA 1..68 1..67 244 67.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25119-PA 69 GM25119-PA 1..69 1..69 361 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14154-PA 69 GD14154-PA 1..69 1..69 364 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12604-PA 71 GJ12604-PA 3..68 2..67 270 74.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23681-PA 71 GK23681-PA 3..68 2..67 289 78.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20806-PA 69 GE20806-PA 1..69 1..69 357 97.1 Plus