Clone RH39904 Report

Search the DGRC for RH39904

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:399
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCG4017-RA
Protein status:RH39904.pep: gold
Preliminary Size:1275
Sequenced Size:1629

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4017 2002-01-01 Sim4 clustering to Release 2
CG4017 2002-05-31 Blastp of sequenced clone
CG4017 2003-01-01 Sim4 clustering to Release 3
CG4017 2008-04-29 Release 5.5 accounting
CG4017 2008-08-15 Release 5.9 accounting
CG4017 2008-12-18 5.12 accounting

Clone Sequence Records

RH39904.complete Sequence

1629 bp (1629 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118431

> RH39904.complete
GACTAGTGCCAATATGAAGCTACTGCTGTTGCTACTGTCGGTTAATATTC
TTATTTTTTGCTTGGCTGAACGCCAGAGGTTCGACAACTACAAGGTCTAT
AGAGTAAGTCCAGTGAAGGCGAATCAACTGGAGGGACTGCGATCTTTGGA
GGCGAATAGCGAGGATGCTCTGGTCCTAAACAATCTGCATCTTGGGCCCA
CGGATTTTCTGGTGGCGCCCGACTTCGATGGAACCTTTCTGAAACTCGTC
AAAGATTTGGATCTCTCGCCTGAACTCATCGACGCGAATGCCCAAACGAG
TCTATCGCTGGACATAGAGCCCATTGCGGATGCTAATCGGCGAAGTGATG
ACTACTCATGGAGTGAATACCACGAACTTAACGACACGCATCGCTGGATG
CAGAATCTGGTGGGGAAGTATCCGGATGTCGTCAGTGTATTTGTGGCGGG
TCAGAGTTACGAGGGTCGTGAGCTGCTGGGCCTGAGGATTAATCATAACG
ATGGAAGAGCTGAGAAGCAATCCATATTCTTGGAGGCCGGAATGCATGCT
AGGGAATGGATTGGTCCTGCCACGGCCACCTACTTTGCTAACGAGCTACT
CTCCTCTCAGCAGCAGGAGATCATGAATCTAGCCAGATCCTATGTTTGGT
ACATATTGCCCCATGCCAATCCAGACGGTTATGTCTACACCCACAAAACG
AATCGCATGTGGCGCAAGACAAGGAGTCCGCAGGACAAGAACTGCGTTGG
AACGGATCCCAATCGTAACTGGGACTTCCACTGGCGTGAGGTGGGAGCCA
GTTCTGATCCCTGCTCGGAGTCATATGCTGGACCCAAGGCGTTCTCCGAA
CCTGAAGTTCAGACTCTTTCTCAGTTTTTGAAATCGGTGCCGGAACCCAT
GTTCATGTTCCTCTCGCTGCACTCCTTCTCCCAATTGTTGCTATATCCCT
ATGGACACACATCCGCACTGCCGGAAAATCATAGGCAGTTGGAGCAGATC
TTCAATACAGCCGTGGGTGCAATGAAGCGGCGTTATGGAACTCGGTACAC
TGGAGGAAATGTGTACGATGCCATATATCCGGCAGCTGGTTCCAGTATGG
ATTGGGCTTATGGGGTGCTCAACGTTAAGTACTCCTTTACCTACGAGCTA
CGACCGTCTGGGTATAGTTTCTGGACAGGATTTAGATTGCCCGCCGCCCA
AATTATACCAACGGGTCAGGAGACCACAGATTCGTTGGTGGAAATGATTA
AGGCTGCTGCTCAAATCGAGGGTTACAAAATTGAGTAGAAGAGAGAGCTT
ACGACGTTTTTGTTGATAAGATTAATGAAAAGATCTGTTACTTCTGAAAA
AAACTAAACGTAAGCATGTTTTGATTAAAAAGATAACTTGGACAAGCTGA
TAAGATGAAAAGTCCAAATTGGCTTAAAAAGTTTTGGGTAAAAAAAATGA
TTTGATTATATATTATCAATTTTGCGGACTGAAATGTTAGTTTGTGGAAC
AGAATGACTTGTCAAAGTTAGAATATAAACAAAAGCTAGAGCTTATAAAT
TTGGTTTAATGATGAATATAACTAATACTAAAAATGTAATTTATAAATTT
CAAATATTAAGACAAAAAAAAAAAAAAAA

RH39904.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG4017-RA 1664 CG4017-RA 47..1663 1..1615 8015 99.8 Plus
CG17633-RA 1349 CG17633-RA 678..751 647..720 220 86.4 Plus
CG17633-RA 1349 CG17633-RA 934..1007 906..979 160 81 Plus
CG17633-RA 1349 CG17633-RA 1073..1135 1045..1107 150 82.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9766651..9767565 700..1613 4435 99.5 Plus
chr2L 23010047 chr2L 9765898..9766597 1..700 3485 99.9 Plus
chr2L 23010047 chr2L 9768582..9768655 647..720 220 86.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9767812..9768729 700..1615 4510 99.7 Plus
2L 23513712 2L 9767059..9767758 1..700 3500 100 Plus
2L 23513712 2L 9769744..9769817 647..720 220 86.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9767812..9768729 700..1615 4520 99.6 Plus
2L 23513712 2L 9767059..9767758 1..700 3500 100 Plus
2L 23513712 2L 9769744..9769817 647..720 220 86.4 Plus
2L 23513712 2L 9770000..9770073 906..979 160 81 Plus
2L 23513712 2L 9770139..9770201 1045..1107 150 82.5 Plus
Blast to na_te.dros performed 2019-03-16 19:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 3171..3294 1427..1307 116 59.2 Minus

RH39904.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:00:10 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9765898..9766597 1..700 99 -> Plus
chr2L 9766652..9767565 701..1613 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:11 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 1..1275 14..1288 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:33:31 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 1..1275 14..1288 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:53 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 1..1275 14..1288 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:25:04 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 1..1275 14..1288 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:48:34 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 1..1275 14..1288 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:04:21 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 1..1615 1..1613 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:33:31 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 1..1615 1..1613 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:53 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 2..1616 1..1613 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:25:04 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 1..1615 1..1613 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:48:34 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
CG4017-RA 2..1616 1..1613 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:10 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9767059..9767758 1..700 100 -> Plus
2L 9767813..9768727 701..1613 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:10 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9767059..9767758 1..700 100 -> Plus
2L 9767813..9768727 701..1613 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:10 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9767059..9767758 1..700 100 -> Plus
2L 9767813..9768727 701..1613 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:53 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9767059..9767758 1..700 100 -> Plus
arm_2L 9767813..9768727 701..1613 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:57:30 Download gff for RH39904.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9767059..9767758 1..700 100 -> Plus
2L 9767813..9768727 701..1613 99   Plus

RH39904.hyp Sequence

Translation from 0 to 1287

> RH39904.hyp
TSANMKLLLLLLSVNILIFCLAERQRFDNYKVYRVSPVKANQLEGLRSLE
ANSEDALVLNNLHLGPTDFLVAPDFDGTFLKLVKDLDLSPELIDANAQTS
LSLDIEPIADANRRSDDYSWSEYHELNDTHRWMQNLVGKYPDVVSVFVAG
QSYEGRELLGLRINHNDGRAEKQSIFLEAGMHAREWIGPATATYFANELL
SSQQQEIMNLARSYVWYILPHANPDGYVYTHKTNRMWRKTRSPQDKNCVG
TDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLKSVPEPM
FMFLSLHSFSQLLLYPYGHTSALPENHRQLEQIFNTAVGAMKRRYGTRYT
GGNVYDAIYPAAGSSMDWAYGVLNVKYSFTYELRPSGYSFWTGFRLPAAQ
IIPTGQETTDSLVEMIKAAAQIEGYKIE*

RH39904.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG4017-PA 424 CG4017-PA 1..424 5..428 2245 100 Plus
CG17633-PA 430 CG17633-PA 2..419 2..415 1111 50 Plus
CG14820-PA 416 CG14820-PA 1..414 8..423 745 37.6 Plus
CG7025-PA 429 CG7025-PA 25..422 23..425 732 37.6 Plus
CG18585-PB 422 CG18585-PB 1..421 5..425 704 36.2 Plus

RH39904.pep Sequence

Translation from 13 to 1287

> RH39904.pep
MKLLLLLLSVNILIFCLAERQRFDNYKVYRVSPVKANQLEGLRSLEANSE
DALVLNNLHLGPTDFLVAPDFDGTFLKLVKDLDLSPELIDANAQTSLSLD
IEPIADANRRSDDYSWSEYHELNDTHRWMQNLVGKYPDVVSVFVAGQSYE
GRELLGLRINHNDGRAEKQSIFLEAGMHAREWIGPATATYFANELLSSQQ
QEIMNLARSYVWYILPHANPDGYVYTHKTNRMWRKTRSPQDKNCVGTDPN
RNWDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLKSVPEPMFMFL
SLHSFSQLLLYPYGHTSALPENHRQLEQIFNTAVGAMKRRYGTRYTGGNV
YDAIYPAAGSSMDWAYGVLNVKYSFTYELRPSGYSFWTGFRLPAAQIIPT
GQETTDSLVEMIKAAAQIEGYKIE*

RH39904.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22809-PA 426 GF22809-PA 1..424 1..424 1896 80.4 Plus
Dana\GF22810-PA 427 GF22810-PA 22..415 18..411 1146 51.8 Plus
Dana\GF23551-PA 416 GF23551-PA 5..414 4..419 728 37.6 Plus
Dana\GF23552-PA 416 GF23552-PA 5..414 6..419 725 38.1 Plus
Dana\GF14014-PA 428 GF14014-PA 1..422 8..421 709 36.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10054-PA 427 GG10054-PA 18..427 15..424 2098 93.2 Plus
Dere\GG10055-PA 429 GG10055-PA 7..418 3..411 1124 49.9 Plus
Dere\GG23518-PA 429 GG23518-PA 21..422 15..421 733 37.8 Plus
Dere\GG14391-PA 416 GG14391-PA 2..414 3..419 731 37.6 Plus
Dere\GG23519-PA 422 GG23519-PA 1..421 1..421 722 37.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25145-PA 426 GH25145-PA 23..416 18..412 1104 49.4 Plus
Dgri\GH25146-PA 426 GH25146-PA 23..424 18..421 1088 48.5 Plus
Dgri\GH10072-PA 421 GH10072-PA 1..412 1..412 738 37.9 Plus
Dgri\GH15366-PA 440 GH15366-PA 21..431 8..418 738 37.3 Plus
Dgri\GH10071-PA 430 GH10071-PA 29..423 19..421 700 36.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG4017-PA 424 CG4017-PA 1..424 1..424 2245 100 Plus
CG17633-PA 430 CG17633-PA 7..419 3..411 1106 50.1 Plus
CG14820-PA 416 CG14820-PA 1..414 4..419 745 37.6 Plus
CG7025-PA 429 CG7025-PA 25..422 19..421 732 37.6 Plus
CG18585-PB 422 CG18585-PB 1..421 1..421 704 36.2 Plus
CG18585-PA 422 CG18585-PA 1..421 1..421 704 36.2 Plus
CG2915-PA 453 CG2915-PA 51..453 19..422 667 34.4 Plus
CG2915-PB 453 CG2915-PB 51..453 19..422 667 34.4 Plus
CG4408-PB 467 CG4408-PB 68..465 22..421 660 35.7 Plus
CG4408-PA 479 CG4408-PA 80..477 22..421 660 35.7 Plus
CG8560-PB 418 CG8560-PB 7..415 3..416 646 36.9 Plus
CG8560-PA 418 CG8560-PA 7..415 3..416 646 36.9 Plus
CG8562-PA 424 CG8562-PA 1..402 1..397 627 36.7 Plus
CG3108-PA 1132 CG3108-PA 762..1120 64..423 623 36.7 Plus
CG18417-PA 427 CG18417-PA 6..422 4..417 622 35.4 Plus
CG12374-PA 422 CG12374-PA 1..417 1..417 566 31.4 Plus
CG3097-PA 445 CG3097-PA 103..427 84..403 533 33.8 Plus
CG32379-PB 344 CG32379-PB 47..339 119..398 477 34.3 Plus
CG8945-PC 1430 CG8945-PC 978..1427 20..412 470 27.9 Plus
CG8563-PB 440 CG8563-PB 136..435 109..413 440 34.2 Plus
CG8563-PA 440 CG8563-PA 136..435 109..413 440 34.2 Plus
CG42264-PB 521 CG42264-PB 211..513 115..408 432 30.5 Plus
CG42264-PA 634 CG42264-PA 324..626 115..408 432 30.5 Plus
CG8564-PA 504 CG8564-PA 38..360 119..413 364 30.6 Plus
CG8564-PC 520 CG8564-PC 54..376 119..413 364 30.6 Plus
CG8539-PB 385 CG8539-PB 46..303 127..383 357 33 Plus
CG8539-PA 385 CG8539-PA 46..303 127..383 357 33 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20130-PA 426 GI20130-PA 20..423 15..419 1132 50.4 Plus
Dmoj\GI20107-PA 426 GI20107-PA 23..416 18..412 1082 49.6 Plus
Dmoj\GI20119-PA 426 GI20119-PA 23..426 18..422 1079 47.9 Plus
Dmoj\GI15622-PA 426 GI15622-PA 23..424 18..421 911 42.8 Plus
Dmoj\GI16517-PA 421 GI16517-PA 7..419 3..419 766 40.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18933-PA 426 GL18933-PA 16..426 16..424 1781 77.6 Plus
Dper\GL18934-PA 425 GL18934-PA 22..414 18..411 1094 49.5 Plus
Dper\GL18860-PA 429 GL18860-PA 27..422 20..421 748 39.6 Plus
Dper\GL13278-PA 358 GL13278-PA 53..356 115..419 680 42.9 Plus
Dper\GL13854-PA 434 GL13854-PA 88..432 70..421 662 40.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17870-PA 426 GA17870-PA 19..426 19..424 1764 77.7 Plus
Dpse\GA14587-PA 425 GA14587-PA 22..414 18..411 1101 49.7 Plus
Dpse\GA13272-PA 416 GA13272-PA 5..414 2..419 764 39.5 Plus
Dpse\GA15002-PA 423 GA15002-PA 3..422 4..421 744 38.4 Plus
Dpse\GA20041-PA 429 GA20041-PA 27..414 20..412 742 39.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17686-PA 424 GM17686-PA 1..424 1..424 2219 96.5 Plus
Dsec\GM17695-PA 429 GM17695-PA 7..418 3..411 1122 50.1 Plus
Dsec\GM14804-PA 416 GM14804-PA 2..414 3..419 754 37.8 Plus
Dsec\GM13458-PA 429 GM13458-PA 9..422 3..421 726 36.5 Plus
Dsec\GM13467-PA 422 GM13467-PA 1..421 1..421 703 35.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23628-PA 424 GD23628-PA 1..424 1..424 2221 96.2 Plus
Dsim\GD23629-PA 430 GD23629-PA 7..419 3..411 1138 50.1 Plus
Dsim\GD22481-PA 429 GD22481-PA 9..422 3..421 725 36.5 Plus
Dsim\GD22482-PA 422 GD22482-PA 1..421 1..421 709 36.6 Plus
Dsim\GD13057-PA 418 GD13057-PA 1..416 3..417 649 36.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13514-PA 426 GJ13514-PA 23..416 18..412 1114 49.1 Plus
Dvir\GJ13502-PA 426 GJ13502-PA 23..416 18..412 1086 49.1 Plus
Dvir\GJ16228-PA 421 GJ16228-PA 1..420 1..421 778 40.1 Plus
Dvir\GJ16227-PA 430 GJ16227-PA 27..424 17..421 767 40.3 Plus
Dvir\GJ13115-PA 416 GJ13115-PA 18..414 18..419 732 37.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24193-PA 421 GK24193-PA 19..420 17..419 1634 73 Plus
Dwil\GK24194-PA 426 GK24194-PA 23..415 18..411 1111 51 Plus
Dwil\GK23953-PA 418 GK23953-PA 1..415 1..418 781 38.9 Plus
Dwil\GK23952-PA 418 GK23952-PA 1..415 1..418 781 39.9 Plus
Dwil\GK12561-PA 417 GK12561-PA 4..413 3..417 750 37.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18868-PA 424 GE18868-PA 1..424 1..424 2201 94.6 Plus
Dyak\GE18869-PA 430 GE18869-PA 7..420 3..412 1141 49.9 Plus
Dyak\GE18344-PA 429 GE18344-PA 21..422 15..421 732 38 Plus
Dyak\GE18345-PA 422 GE18345-PA 1..421 1..421 726 36.6 Plus
Dyak\GE21580-PA 409 GE21580-PA 11..407 18..419 716 37 Plus