Clone RH40237 Report

Search the DGRC for RH40237

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:402
Well:37
Vector:pFlc-1
Associated Gene/TranscriptTrs23-RA
Protein status:RH40237.pep: gold
Preliminary Size:660
Sequenced Size:730

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9298 2002-01-01 Sim4 clustering to Release 2
CG9298 2003-01-01 Sim4 clustering to Release 3
CG9298 2008-04-29 Stopped prior to 5.5

Clone Sequence Records

RH40237.complete Sequence

730 bp assembled on 2010-02-03

GenBank Submission: BT120293.1

> RH40237.complete
GACTCCTAGGAAACTTAGAATTAGTAATAGTAAGAAATGATTATATATGG
CGTCTATATAGTTAGTAAATCGGGTGGCCTTATATTCAACCTGGACAACA
ATGTGCCACGCATTGAGCACGAGAAGACCTTTACATACCCTCTGGACTTG
GTGCTGGACTACGATTCCAAGAAGGTATCGGTCTCGTTCAACAGAAAGGA
TGGAATAAATGTGGGCCATGTCCTGGTGGCGGTCAACGGTATGCCCGTCA
ATGGAGTCACCCTGGATGATGGACGCGATGTGAGGACGACACTGGATGCA
CCGGAGAACTATCCCATTAACCTGAAGTTCAGCCGGCCAAAGATGACCAC
CAACGAGAAAATCTTTCTGGCCAGCATGTTCTACCCGCTGTTCGCCATCG
CCAGCCAACTGAGTCCGGAGCCCAAGAGTTCCGGCATCGAGATCCTAGAG
GCGGACACTTTCACGCTGCACTGCTTCCAAACGCTGACCGGAATCAAGTT
CATTATAATCTCGGAAACGGGTCTCAATGGCATTGATCTGCTGCTGCGAA
AGGTTTACGAGCTGTACTCAGACTACGTGCTCAAGAACCCCTTCTACTCC
CTGGAGATGCCCATTCGATGCGAGCTCTTCGACAACAAGCTCCAAGAGCT
CCTCGCCCAGGTCGAGAAGACGGGCATTAGCAATATCGATAAATAAACGT
TAGTTAGTCTTTGTAAAAAAAAAAAAAAAA

RH40237.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Trs23-RA 903 Trs23-RA 76..788 4..716 3565 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8685426..8685929 211..714 2430 98.8 Plus
chr2L 23010047 chr2L 8685162..8685369 4..211 980 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8686549..8687054 211..716 2530 100 Plus
2L 23513712 2L 8686285..8686492 4..211 1040 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8686549..8687054 211..716 2530 100 Plus
2L 23513712 2L 8686285..8686492 4..211 1040 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:49:42 has no hits.

RH40237.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:50:52 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8685159..8685369 1..211 97 -> Plus
chr2L 8685427..8685929 212..714 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-03 16:51:09 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
CG9298-RA 1..660 37..696 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:17:36 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
Trs23-RA 1..660 37..696 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:02 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
Trs23-RA 1..660 37..696 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:19 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
Trs23-RA 1..660 37..696 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-03 16:51:07 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
CG9298-RA 52..765 1..714 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:17:36 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
Trs23-RA 52..765 1..714 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:02 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
Trs23-RA 52..765 1..714 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:19 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
Trs23-RA 52..765 1..714 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:52 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8686282..8686492 1..211 99 -> Plus
2L 8686550..8687052 212..714 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:52 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8686282..8686492 1..211 99 -> Plus
2L 8686550..8687052 212..714 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:52 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8686282..8686492 1..211 99 -> Plus
2L 8686550..8687052 212..714 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:02 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8686282..8686492 1..211 99 -> Plus
arm_2L 8686550..8687052 212..714 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:07:02 Download gff for RH40237.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8686282..8686492 1..211 99 -> Plus
2L 8686550..8687052 212..714 100   Plus

RH40237.hyp Sequence

Translation from 36 to 695

> RH40237.hyp
MIIYGVYIVSKSGGLIFNLDNNVPRIEHEKTFTYPLDLVLDYDSKKVSVS
FNRKDGINVGHVLVAVNGMPVNGVTLDDGRDVRTTLDAPENYPINLKFSR
PKMTTNEKIFLASMFYPLFAIASQLSPEPKSSGIEILEADTFTLHCFQTL
TGIKFIIISETGLNGIDLLLRKVYELYSDYVLKNPFYSLEMPIRCELFDN
KLQELLAQVEKTGISNIDK*

RH40237.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
Trs23-PA 219 CG9298-PA 1..219 1..219 1124 100 Plus

RH40237.pep Sequence

Translation from 36 to 695

> RH40237.pep
MIIYGVYIVSKSGGLIFNLDNNVPRIEHEKTFTYPLDLVLDYDSKKVSVS
FNRKDGINVGHVLVAVNGMPVNGVTLDDGRDVRTTLDAPENYPINLKFSR
PKMTTNEKIFLASMFYPLFAIASQLSPEPKSSGIEILEADTFTLHCFQTL
TGIKFIIISETGLNGIDLLLRKVYELYSDYVLKNPFYSLEMPIRCELFDN
KLQELLAQVEKTGISNIDK*

RH40237.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15539-PA 219 GF15539-PA 1..219 1..219 1101 94.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25299-PA 219 GG25299-PA 1..219 1..219 1131 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11277-PA 219 GH11277-PA 1..219 1..219 1069 91.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Trs23-PA 219 CG9298-PA 1..219 1..219 1124 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17696-PA 219 GI17696-PA 1..219 1..219 1065 90.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25559-PA 197 GL25559-PA 1..193 1..193 957 93.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21680-PA 219 GA21680-PA 1..219 1..219 1107 95.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17108-PA 219 GM17108-PA 1..219 1..219 1140 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23559-PA 219 GD23559-PA 1..219 1..219 1140 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11301-PA 219 GJ11301-PA 1..219 1..219 1094 93.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18753-PA 219 GK18753-PA 1..219 1..219 1079 91.8 Plus
Dwil\GK14119-PA 145 GK14119-PA 41..145 114..217 156 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18790-PA 219 GE18790-PA 1..219 1..219 1138 98.6 Plus