BDGP Sequence Production Resources |
Search the DGRC for RH40291
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 402 |
Well: | 91 |
Vector: | pFlc-1 |
Associated Gene/Transcript | fit-RA |
Protein status: | RH40291.pep: gold |
Preliminary Size: | 529 |
Sequenced Size: | 548 |
Gene | Date | Evidence |
---|---|---|
CG17820 | 2001-12-17 | Blastp of sequenced clone |
CG17820 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17820 | 2003-01-01 | Sim4 clustering to Release 3 |
fit | 2008-04-29 | Release 5.5 accounting |
fit | 2008-08-15 | Release 5.9 accounting |
fit | 2008-12-18 | 5.12 accounting |
548 bp (548 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071724
> RH40291.complete GACAGTTTAACAGCGATCGTTGAAATGAACTCAACTCTGGTGATTCTACT TCTTTCGGCTCTGGCTTTGGTGCAGGCCAGGAATATTCGTTGGTCTGAGG AGGACAACTCGTCCCAAGGTCCAAGTCTAAGCCACCCGCATCCGCACTCT GTCAACTGGCCCTGTGATGTGGGTCACTTCCCAGAGGCATTCATTCTAAT GCACAAGGTGGATAAGCGACTGGAACGAATTGACAACGAGAGTACCAAGA AACGGATCGAGAACTACGCCGTCAATCAGTTGAGGCAGTGCATCTTGGAT GGCCAGATGGACGTGCACTGCGTTAGGCGTTCGATTGGATACACCATGTC ATTCATTCACCACCAAATGAGCCAGGCGAATGGAATGTAAGCTCACGACT TGGTGATCAGTTGATATAATTTAAGGACATTCCTTTAGCCACCTTTTTTT TGCAAAATGCATTTTAATAATCAAATCCTTTCAAACGAACTAATTAGTAA CAAATTATCAAAATAAATTAAGTTTAAATAATAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 17707640..17708170 | 532..2 | 2580 | 99.1 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 21883922..21884454 | 534..2 | 2665 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 21624753..21625285 | 534..2 | 2665 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 17707676..17708170 | 1..496 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..366 | 25..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..366 | 25..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..366 | 25..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..366 | 25..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..366 | 25..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..531 | 2..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..531 | 2..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..531 | 2..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..531 | 2..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
fit-RA | 1..531 | 2..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21883924..21884454 | 1..532 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21883924..21884454 | 1..532 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21883924..21884454 | 1..532 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 17709646..17710176 | 1..532 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21624755..21625285 | 1..532 | 99 | Minus |
Translation from 3 to 389
> RH40291.hyp SLTAIVEMNSTLVILLLSALALVQARNIRWSEEDNSSQGPSLSHPHPHSV NWPCDVGHFPEAFILMHKVDKRLERIDNESTKKRIENYAVNQLRQCILDG QMDVHCVRRSIGYTMSFIHHQMSQANGM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
fit-PA | 121 | CG17820-PA | 1..121 | 8..128 | 644 | 100 | Plus |
Translation from 24 to 389
> RH40291.pep MNSTLVILLLSALALVQARNIRWSEEDNSSQGPSLSHPHPHSVNWPCDVG HFPEAFILMHKVDKRLERIDNESTKKRIENYAVNQLRQCILDGQMDVHCV RRSIGYTMSFIHHQMSQANGM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19898-PA | 112 | GF19898-PA | 1..109 | 1..117 | 249 | 48.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12551-PA | 116 | GG12551-PA | 1..116 | 1..121 | 544 | 85.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17072-PA | 119 | GH17072-PA | 1..113 | 1..111 | 251 | 47.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
fit-PA | 121 | CG17820-PA | 1..121 | 1..121 | 644 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10572-PA | 119 | GI10572-PA | 1..117 | 1..117 | 285 | 47.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23731-PA | 122 | GL23731-PA | 1..120 | 1..119 | 316 | 54.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14682-PA | 122 | GA14682-PA | 1..120 | 1..119 | 322 | 55 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19377-PA | 56 | GM19377-PA | 1..32 | 59..90 | 159 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18493-PA | 121 | GD18493-PA | 1..121 | 1..121 | 602 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22928-PA | 121 | GJ22928-PA | 1..119 | 1..117 | 288 | 49.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13013-PA | 122 | GK13013-PA | 1..114 | 1..113 | 307 | 55.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24076-PA | 123 | GE24076-PA | 1..123 | 1..121 | 508 | 84.6 | Plus |