Clone RH40291 Report

Search the DGRC for RH40291

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:402
Well:91
Vector:pFlc-1
Associated Gene/Transcriptfit-RA
Protein status:RH40291.pep: gold
Preliminary Size:529
Sequenced Size:548

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17820 2001-12-17 Blastp of sequenced clone
CG17820 2002-01-01 Sim4 clustering to Release 2
CG17820 2003-01-01 Sim4 clustering to Release 3
fit 2008-04-29 Release 5.5 accounting
fit 2008-08-15 Release 5.9 accounting
fit 2008-12-18 5.12 accounting

Clone Sequence Records

RH40291.complete Sequence

548 bp (548 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071724

> RH40291.complete
GACAGTTTAACAGCGATCGTTGAAATGAACTCAACTCTGGTGATTCTACT
TCTTTCGGCTCTGGCTTTGGTGCAGGCCAGGAATATTCGTTGGTCTGAGG
AGGACAACTCGTCCCAAGGTCCAAGTCTAAGCCACCCGCATCCGCACTCT
GTCAACTGGCCCTGTGATGTGGGTCACTTCCCAGAGGCATTCATTCTAAT
GCACAAGGTGGATAAGCGACTGGAACGAATTGACAACGAGAGTACCAAGA
AACGGATCGAGAACTACGCCGTCAATCAGTTGAGGCAGTGCATCTTGGAT
GGCCAGATGGACGTGCACTGCGTTAGGCGTTCGATTGGATACACCATGTC
ATTCATTCACCACCAAATGAGCCAGGCGAATGGAATGTAAGCTCACGACT
TGGTGATCAGTTGATATAATTTAAGGACATTCCTTTAGCCACCTTTTTTT
TGCAAAATGCATTTTAATAATCAAATCCTTTCAAACGAACTAATTAGTAA
CAAATTATCAAAATAAATTAAGTTTAAATAATAAAAAAAAAAAAAAAA

RH40291.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
fit-RA 537 fit-RA 1..533 2..534 2665 100 Plus
CG31465.a 3079 CG31465.a 3011..3079 534..466 345 100 Minus
CG31465.b 3113 CG31465.b 3045..3113 534..466 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17707640..17708170 532..2 2580 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21883922..21884454 534..2 2665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21624753..21625285 534..2 2665 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:28:30 has no hits.

RH40291.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:29:13 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17707676..17708170 1..496 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:16 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..366 25..390 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:35 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..366 25..390 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:54:52 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..366 25..390 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:21 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..366 25..390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:28:20 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..366 25..390 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:23:46 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:35 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:54:52 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:21 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:28:20 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
fit-RA 1..531 2..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:29:13 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21883924..21884454 1..532 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:29:13 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21883924..21884454 1..532 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:29:13 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21883924..21884454 1..532 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:54:52 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17709646..17710176 1..532 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:23 Download gff for RH40291.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21624755..21625285 1..532 99   Minus

RH40291.hyp Sequence

Translation from 3 to 389

> RH40291.hyp
SLTAIVEMNSTLVILLLSALALVQARNIRWSEEDNSSQGPSLSHPHPHSV
NWPCDVGHFPEAFILMHKVDKRLERIDNESTKKRIENYAVNQLRQCILDG
QMDVHCVRRSIGYTMSFIHHQMSQANGM*

RH40291.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
fit-PA 121 CG17820-PA 1..121 8..128 644 100 Plus

RH40291.pep Sequence

Translation from 24 to 389

> RH40291.pep
MNSTLVILLLSALALVQARNIRWSEEDNSSQGPSLSHPHPHSVNWPCDVG
HFPEAFILMHKVDKRLERIDNESTKKRIENYAVNQLRQCILDGQMDVHCV
RRSIGYTMSFIHHQMSQANGM*

RH40291.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19898-PA 112 GF19898-PA 1..109 1..117 249 48.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12551-PA 116 GG12551-PA 1..116 1..121 544 85.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17072-PA 119 GH17072-PA 1..113 1..111 251 47.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
fit-PA 121 CG17820-PA 1..121 1..121 644 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10572-PA 119 GI10572-PA 1..117 1..117 285 47.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23731-PA 122 GL23731-PA 1..120 1..119 316 54.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14682-PA 122 GA14682-PA 1..120 1..119 322 55 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19377-PA 56 GM19377-PA 1..32 59..90 159 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18493-PA 121 GD18493-PA 1..121 1..121 602 91.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22928-PA 121 GJ22928-PA 1..119 1..117 288 49.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13013-PA 122 GK13013-PA 1..114 1..113 307 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24076-PA 123 GE24076-PA 1..123 1..121 508 84.6 Plus