Clone RH40423 Report

Search the DGRC for RH40423

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:404
Well:23
Vector:pFlc-1
Associated Gene/TranscriptBet1-RA
Protein status:RH40423.pep: gold
Preliminary Size:354
Sequenced Size:649

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14084 2002-01-01 Sim4 clustering to Release 2
CG14084 2002-04-22 Blastp of sequenced clone
CG14084 2003-01-01 Sim4 clustering to Release 3
CG14084 2008-04-29 Release 5.5 accounting
CG14084 2008-08-15 Release 5.9 accounting
CG14084 2008-12-18 5.12 accounting

Clone Sequence Records

RH40423.complete Sequence

649 bp (649 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113588

> RH40423.complete
GACTCCGCTTTGGTCACACTGCTCGGCGACTAAAAATTGAATTGCATGAG
AATTTAAAAAGTTTCGTTTAATAAGTAGAGGCATTAGTCAACCGATTCTG
GAAATCACAACACGAGGTCAAGGGTCAATGCACAGTCAACCACAAAGGTT
GAGCCAAGAAGCGTATATCCCAACAGCTGTTCTGCCGCTGGCAATCCGGA
TGCCAAACTGGCACACTCGGGGAGCAGTATGCGCCGCAACAACTACCCGT
ACCAGCCCCTAAACCAGCACCCTTCAGGGCCCCATCCTGCGAGCCACGAC
GCCTTGGAGGCGGAAAACGAGCAGGCGGCGGAGGAGTTGAAGCAGAAGAT
CGGGGCCCTGAAGTCCCTCACCATCGATATAGGCAATGAGGTGCGCTACC
AGGACAAGCTGCTGCGCGGCATCGACGACGACATGGACCGGACGAGTGGA
TTTCTGGGCAACGCGATGACGCGGGTGGTGCGACTGGCCAAACAGGGCGG
TGGTGCTCGCCAAATGTGCTACATGTTCCTCTTCATCCTCGTCGTGTTCT
TAATCCTCTGGATAACCCTAAAGTTTAAGTAGTTGTTGGTAATTTTATAA
AATATATACCCACATATTTGTATGGTTTAGTGTAAAAAAAAAAAAAAAA

RH40423.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
Bet1-RA 863 Bet1-RA 65..697 2..634 3165 100 Plus
Bet1-RB 911 Bet1-RB 303..745 192..634 2215 100 Plus
Bet1-RB 911 Bet1-RB 65..254 2..191 950 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19251175..19251617 191..633 2185 99.5 Plus
chr3L 24539361 chr3L 19250881..19251070 2..191 920 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:28:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19261712..19262155 191..634 2220 100 Plus
3L 28110227 3L 19261418..19261607 2..191 950 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19254812..19255255 191..634 2220 100 Plus
3L 28103327 3L 19254518..19254707 2..191 950 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:23:30 has no hits.

RH40423.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:24:36 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19250880..19251070 1..191 98 -> Plus
chr3L 19251176..19251617 192..633 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:17 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
CG14084-RB 1..354 229..582 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:58:43 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
Bet1-RB 1..354 229..582 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:27:53 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
Bet1-RA 1..354 229..582 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:02 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
CG14084-RB 1..354 229..582 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:37:38 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
Bet1-RA 1..354 229..582 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:39:10 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
CG14084-RA 2..633 2..633 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:58:43 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
Bet1-RA 2..633 2..633 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:27:53 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
Bet1-RA 24..656 1..633 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:02 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
CG14084-RA 2..633 2..633 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:37:38 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
Bet1-RA 24..656 1..633 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:24:36 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19261417..19261607 1..191 99 -> Plus
3L 19261713..19262154 192..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:24:36 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19261417..19261607 1..191 99 -> Plus
3L 19261713..19262154 192..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:24:36 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19261417..19261607 1..191 99 -> Plus
3L 19261713..19262154 192..633 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:27:53 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19254517..19254707 1..191 99 -> Plus
arm_3L 19254813..19255254 192..633 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:05 Download gff for RH40423.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19254813..19255254 192..633 100   Plus
3L 19254517..19254707 1..191 99 -> Plus

RH40423.hyp Sequence

Translation from 228 to 581

> RH40423.hyp
MRRNNYPYQPLNQHPSGPHPASHDALEAENEQAAEELKQKIGALKSLTID
IGNEVRYQDKLLRGIDDDMDRTSGFLGNAMTRVVRLAKQGGGARQMCYMF
LFILVVFLILWITLKFK*

RH40423.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
Bet1-PB 117 CG14084-PB 1..117 1..117 610 100 Plus
Bet1-PA 117 CG14084-PA 1..117 1..117 610 100 Plus

RH40423.pep Sequence

Translation from 228 to 581

> RH40423.pep
MRRNNYPYQPLNQHPSGPHPASHDALEAENEQAAEELKQKIGALKSLTID
IGNEVRYQDKLLRGIDDDMDRTSGFLGNAMTRVVRLAKQGGGARQMCYMF
LFILVVFLILWITLKFK*

RH40423.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23664-PA 117 GF23664-PA 1..117 1..117 511 91.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16025-PA 117 GG16025-PA 1..117 1..117 613 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17166-PA 118 GH17166-PA 1..118 1..117 413 83.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Bet1-PB 117 CG14084-PB 1..117 1..117 610 100 Plus
Bet1-PA 117 CG14084-PA 1..117 1..117 610 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11781-PA 117 GI11781-PA 1..117 1..117 423 84.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20925-PA 99 GL20925-PA 1..95 1..94 386 92.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12752-PA 118 GA12752-PA 1..118 1..117 423 91.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15015-PA 117 GM15015-PA 1..117 1..117 619 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14792-PA 117 GD14792-PA 1..117 1..117 619 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13483-PA 117 GJ13483-PA 1..117 1..117 433 86.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20170-PA 119 GK20170-PA 1..101 1..99 380 86.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23077-PA 117 GE23077-PA 1..117 1..117 535 95.7 Plus
Dyak\GE19594-PA 117 GE19594-PA 1..117 1..117 535 95.7 Plus