BDGP Sequence Production Resources |
Search the DGRC for RH40423
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 404 |
Well: | 23 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Bet1-RA |
Protein status: | RH40423.pep: gold |
Preliminary Size: | 354 |
Sequenced Size: | 649 |
Gene | Date | Evidence |
---|---|---|
CG14084 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14084 | 2002-04-22 | Blastp of sequenced clone |
CG14084 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14084 | 2008-04-29 | Release 5.5 accounting |
CG14084 | 2008-08-15 | Release 5.9 accounting |
CG14084 | 2008-12-18 | 5.12 accounting |
649 bp (649 high quality bases) assembled on 2002-04-22
GenBank Submission: AY113588
> RH40423.complete GACTCCGCTTTGGTCACACTGCTCGGCGACTAAAAATTGAATTGCATGAG AATTTAAAAAGTTTCGTTTAATAAGTAGAGGCATTAGTCAACCGATTCTG GAAATCACAACACGAGGTCAAGGGTCAATGCACAGTCAACCACAAAGGTT GAGCCAAGAAGCGTATATCCCAACAGCTGTTCTGCCGCTGGCAATCCGGA TGCCAAACTGGCACACTCGGGGAGCAGTATGCGCCGCAACAACTACCCGT ACCAGCCCCTAAACCAGCACCCTTCAGGGCCCCATCCTGCGAGCCACGAC GCCTTGGAGGCGGAAAACGAGCAGGCGGCGGAGGAGTTGAAGCAGAAGAT CGGGGCCCTGAAGTCCCTCACCATCGATATAGGCAATGAGGTGCGCTACC AGGACAAGCTGCTGCGCGGCATCGACGACGACATGGACCGGACGAGTGGA TTTCTGGGCAACGCGATGACGCGGGTGGTGCGACTGGCCAAACAGGGCGG TGGTGCTCGCCAAATGTGCTACATGTTCCTCTTCATCCTCGTCGTGTTCT TAATCCTCTGGATAACCCTAAAGTTTAAGTAGTTGTTGGTAATTTTATAA AATATATACCCACATATTTGTATGGTTTAGTGTAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 19250880..19251070 | 1..191 | 98 | -> | Plus |
chr3L | 19251176..19251617 | 192..633 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14084-RB | 1..354 | 229..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet1-RB | 1..354 | 229..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet1-RA | 1..354 | 229..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14084-RB | 1..354 | 229..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet1-RA | 1..354 | 229..582 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14084-RA | 2..633 | 2..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet1-RA | 2..633 | 2..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet1-RA | 24..656 | 1..633 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14084-RA | 2..633 | 2..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet1-RA | 24..656 | 1..633 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19261417..19261607 | 1..191 | 99 | -> | Plus |
3L | 19261713..19262154 | 192..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19261417..19261607 | 1..191 | 99 | -> | Plus |
3L | 19261713..19262154 | 192..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19261417..19261607 | 1..191 | 99 | -> | Plus |
3L | 19261713..19262154 | 192..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 19254517..19254707 | 1..191 | 99 | -> | Plus |
arm_3L | 19254813..19255254 | 192..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19254813..19255254 | 192..633 | 100 | Plus | |
3L | 19254517..19254707 | 1..191 | 99 | -> | Plus |
Translation from 228 to 581
> RH40423.hyp MRRNNYPYQPLNQHPSGPHPASHDALEAENEQAAEELKQKIGALKSLTID IGNEVRYQDKLLRGIDDDMDRTSGFLGNAMTRVVRLAKQGGGARQMCYMF LFILVVFLILWITLKFK*
Translation from 228 to 581
> RH40423.pep MRRNNYPYQPLNQHPSGPHPASHDALEAENEQAAEELKQKIGALKSLTID IGNEVRYQDKLLRGIDDDMDRTSGFLGNAMTRVVRLAKQGGGARQMCYMF LFILVVFLILWITLKFK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23664-PA | 117 | GF23664-PA | 1..117 | 1..117 | 511 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16025-PA | 117 | GG16025-PA | 1..117 | 1..117 | 613 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17166-PA | 118 | GH17166-PA | 1..118 | 1..117 | 413 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Bet1-PB | 117 | CG14084-PB | 1..117 | 1..117 | 610 | 100 | Plus |
Bet1-PA | 117 | CG14084-PA | 1..117 | 1..117 | 610 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11781-PA | 117 | GI11781-PA | 1..117 | 1..117 | 423 | 84.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20925-PA | 99 | GL20925-PA | 1..95 | 1..94 | 386 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12752-PA | 118 | GA12752-PA | 1..118 | 1..117 | 423 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15015-PA | 117 | GM15015-PA | 1..117 | 1..117 | 619 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14792-PA | 117 | GD14792-PA | 1..117 | 1..117 | 619 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13483-PA | 117 | GJ13483-PA | 1..117 | 1..117 | 433 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20170-PA | 119 | GK20170-PA | 1..101 | 1..99 | 380 | 86.1 | Plus |