Clone RH41321 Report

Search the DGRC for RH41321

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:413
Well:21
Vector:pFlc-1
Associated Gene/Transcriptglob1-RA
Protein status:RH41321.pep: gold
Sequenced Size:976

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9734 2002-10-24 Blastp of sequenced clone
CG9734 2003-01-01 Sim4 clustering to Release 3
glob1 2008-04-29 Release 5.5 accounting
glob1 2008-08-15 Release 5.9 accounting
glob1 2008-12-18 5.12 accounting

Clone Sequence Records

RH41321.complete Sequence

976 bp (976 high quality bases) assembled on 2002-10-24

GenBank Submission: BT001819

> RH41321.complete
GATTCAGTTCAAATATTAACGGCGTCGTGTGCAGTTGCCTGGCATTTGAT
ATAAACTCCTAAAAGCCATTAAGAGAGGGCCGAACGCTTATAGAGAGCTA
TAGAGTGAAAGCTGAGAAGAACCAAAACGGAGCATAAACATGAACAGCGA
TGAGGTGCAACTGATCAAGAAGACCTGGGAAATCCCCGTGGCAACACCAA
CAGATTCTGGAGCGGCGATACTGACGCAGTTTTTCAACCGCTTTCCGTCC
AACTTGGAGAAGTTCCCCTTCCGCGATGTTCCTTTGGAGGAGCTAAGTGG
AAATGCTCGCTTCCGAGCACATGCCGGCAGAATCATAAGGGTCTTTGACG
AGTCCATCCAGGTCCTGGGCCAGGATGGCGATCTGGAGAAGCTGGACGAG
ATCTGGACCAAAATTGCCGTTAGTCACATTCCGCGGACCGTTTCCAAGGA
GTCTTACAACCAACTGAAAGGAGTTATCCTGGATGTGCTGACAGCTGCCT
GCAGTCTGGACGAGAGTCAAGCGGCCACGTGGGCCAAGCTGGTGGACCAT
GTCTACGGAATCATCTTCAAGGCGATCGACGACGACGGCAACGCCAAGTA
GATGAGGCAGCTGGAGGTGGAGATGCAACCGAATCCGCGGAAGGATGCAA
CTGATGCCAGCCGGTGGCACTTGCAACACATGCACAGCTTATGTAGTTCT
AAGTAATTGATAAATGTTAGCTATTCTCGTTTTGTAATAATGGATGCGAA
TGTCCAAAACAAAAATACACACACAGTGAAAACTTATGTCTGCGTAGAGC
TACTGACACACGCGCACACCCCACACACATACACCCGCACTTGCATTGCT
CTGTAAAGCTTTAACCCATTGTCAGCCTTAAGCACTTGATAGCAAACAAT
ACATGGAATCAGCAAAGGAGAAATAAGAAAGCTTATAAATAAAATCCAGT
TTGAAAGCACAAAAAAAAAAAAAAAA

RH41321.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-RC 1031 glob1-RC 17..974 2..959 4775 99.8 Plus
glob1.c 1683 glob1.c 687..1644 2..959 4775 99.8 Plus
glob1-RE 1068 glob1-RE 369..1029 299..959 3290 99.8 Plus
glob1-RE 1068 glob1-RE 7..304 2..299 1490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11721506..11722004 959..461 2465 99.6 Minus
chr3R 27901430 chr3R 11722355..11722596 299..58 1210 100 Minus
chr3R 27901430 chr3R 11722129..11722290 460..299 810 100 Minus
chr3R 27901430 chr3R 11727022..11727077 57..2 280 100 Minus
chr3R 27901430 chr3R 11729081..11729136 57..2 280 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:29:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15896925..15897423 959..461 2480 99.8 Minus
3R 32079331 3R 15897774..15898015 299..58 1210 100 Minus
3R 32079331 3R 15897548..15897709 460..299 810 100 Minus
3R 32079331 3R 15902443..15902498 57..2 280 100 Minus
3R 32079331 3R 15904502..15904557 57..2 280 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15637756..15638254 959..461 2480 99.7 Minus
3R 31820162 3R 15638605..15638846 299..58 1210 100 Minus
3R 31820162 3R 15638379..15638540 460..299 810 100 Minus
3R 31820162 3R 15645333..15645388 57..2 280 100 Minus
3R 31820162 3R 15643274..15643329 57..2 280 100 Minus
Blast to na_te.dros performed 2019-03-15 16:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 667..717 730..781 113 71.2 Plus

RH41321.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:44:37 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11721505..11722004 461..960 99 <- Minus
chr3R 11722129..11722290 299..460 100 <- Minus
chr3R 11722356..11722596 58..298 100 <- Minus
chr3R 11727022..11727077 1..57 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:27 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RA 1..462 140..601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:06:55 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RA 1..462 140..601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:08:57 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RB 1..462 140..601 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:56:45 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RA 1..462 140..601 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:47:49 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RA 1..462 140..601 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:26:44 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RC 6..963 1..958 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:06:54 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RC 6..963 1..958 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:08:57 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RC 6..963 1..958 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:56:45 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RC 6..963 1..958 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:47:49 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RC 4..961 1..958 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:37 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15897775..15898015 58..298 100 <- Minus
3R 15902443..15902498 1..57 98   Minus
3R 15896924..15897423 461..960 99 <- Minus
3R 15897548..15897709 299..460 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:37 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15897775..15898015 58..298 100 <- Minus
3R 15902443..15902498 1..57 98   Minus
3R 15896924..15897423 461..960 99 <- Minus
3R 15897548..15897709 299..460 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:37 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15897775..15898015 58..298 100 <- Minus
3R 15902443..15902498 1..57 98   Minus
3R 15896924..15897423 461..960 99 <- Minus
3R 15897548..15897709 299..460 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:08:57 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11723497..11723737 58..298 100 <- Minus
arm_3R 11728165..11728220 1..57 98   Minus
arm_3R 11722646..11723145 461..960 99 <- Minus
arm_3R 11723270..11723431 299..460 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:29:13 Download gff for RH41321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15637755..15638254 461..960 99 <- Minus
3R 15638379..15638540 299..460 100 <- Minus
3R 15638606..15638846 58..298 100 <- Minus
3R 15643274..15643329 1..57 98   Minus

RH41321.pep Sequence

Translation from 139 to 600

> RH41321.pep
MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLE
ELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRT
VSKESYNQLKGVILDVLTAACSLDESQAATWAKLVDHVYGIIFKAIDDDG
NAK*

RH41321.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16470-PA 153 GF16470-PA 1..153 1..153 732 88.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20278-PA 153 GG20278-PA 1..153 1..153 788 96.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13816-PA 153 GH13816-PA 1..152 1..152 638 76.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-PF 153 CG9734-PF 1..153 1..153 786 100 Plus
glob1-PD 153 CG9734-PD 1..153 1..153 786 100 Plus
glob1-PA 153 CG9734-PA 1..153 1..153 786 100 Plus
glob1-PB 153 CG9734-PB 1..153 1..153 786 100 Plus
glob1-PC 153 CG9734-PC 1..153 1..153 786 100 Plus
glob1-PE 67 CG9734-PE 1..53 1..53 275 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24641-PA 153 GI24641-PA 1..152 1..152 677 80.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21726-PA 154 GL21726-PA 1..152 1..152 747 90.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\glob1-PB 154 GA21995-PB 1..152 1..152 740 89.5 Plus
Dpse\glob1-PA 154 GA21995-PA 1..152 1..152 740 89.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25744-PA 153 GM25744-PA 1..153 1..153 802 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20318-PA 57 GD20318-PA 1..53 1..53 281 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\glob1-PA 153 GJ23463-PA 1..152 1..152 683 81.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11857-PA 153 GK11857-PA 1..153 1..153 741 87.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26348-PA 153 GE26348-PA 1..153 1..153 803 98.7 Plus

RH41321.hyp Sequence

Translation from 139 to 600

> RH41321.hyp
MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLE
ELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRT
VSKESYNQLKGVILDVLTAACSLDESQAATWAKLVDHVYGIIFKAIDDDG
NAK*

RH41321.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-PF 153 CG9734-PF 1..153 1..153 786 100 Plus
glob1-PD 153 CG9734-PD 1..153 1..153 786 100 Plus
glob1-PA 153 CG9734-PA 1..153 1..153 786 100 Plus
glob1-PB 153 CG9734-PB 1..153 1..153 786 100 Plus
glob1-PC 153 CG9734-PC 1..153 1..153 786 100 Plus