Clone RH42281 Report

Search the DGRC for RH42281

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:422
Well:81
Vector:pFlc-1
Associated Gene/TranscriptKFase-RA
Protein status:RH42281.pep: gold
Preliminary Size:903
Sequenced Size:1019

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9542 2002-01-01 Sim4 clustering to Release 2
CG9542 2002-02-22 Blastp of sequenced clone
CG9542 2003-01-01 Sim4 clustering to Release 3
CG9542 2008-04-29 Release 5.5 accounting
CG9542 2008-08-15 Release 5.9 accounting
CG9542 2008-12-18 5.12 accounting

Clone Sequence Records

RH42281.complete Sequence

1019 bp (1019 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089670

> RH42281.complete
GACTTGCTACTTTGCCTTTCTAATCTGTGTTTGAAGTCCCAGTGACTTAC
TGTCTCTTATCTGGAATGTACAATCCGAGGTGCAAAGACCTTGACCGGGA
CTATTTTCCCAGCTATCATACGACCAGGTTTCAGGATCAGCCGGAACCGA
ATTTGGCCGTGCTAGAGCACTTTGTTCGGGTGACCAAGCAGCATGGCAGG
GAACTGACTGAGAAGCAGGGCATCACTGTGGACCACTTGCGCTACGGAGA
AGGTCGTCAGTTGGTGGATGTGTTCTACAGCGAAAAGACCACCAACCAGG
CGCCGCTTTTCGTCTTCGTGCACGGCGGCTACTGGCAGGAGATGGACATG
AGCATGTCCTGCTCGATTGTGGGTCCCCTGGTGCGGCGTGGATACCGAGT
GGCCGTCATGGACTACAACCTGTGCCCGCAGGTCACCCTCGAGCAGCTGA
TGACCCAGTTCACCCATTTCCTCAACTGGATCTTTGACTACACCGAAATG
ACCAAAGTGTCGTCGCTCACCTTCGCCGGACACTCGGCTGGTGCCCACTT
GCTGGCCCAGATACTCATGCGCCCAAATGTGATTACAGCCCAGCGGAGCA
AGATGGTGTGGGCTTTGATCTTCCTCTGCGGCGTTTACGATCTGAGGGAG
CTCTCTAACTTGGAATCGGTTAATCCCAAAAATATTCTGGGCCTCAACGA
GCGGAATATCGAGTCCGTGTCGCCCATGCTGTGGGAATACACCGATGTTA
CCGTTTGGAACTCCACCAAGATCTACGTGGTGGCCGCCGAGCATGACAGC
ACCACCTTCATCGAGCAAAGTCGCCACTACGCTGATGTGCTGAGAAAGAA
GGGCTACAAGGCGAGCTTTACGCTCTTCAAAGGGTACGACCACTTCGACA
TCATCGAGGAGACGGCCATCGACGATTCGGATGTATCCCGCTTTCTGCGC
AACATTGAAATTGAATAAACTAGGCGCAGTTTCGCTTTGCGTCATCGTTT
CTCAAAAAAAAAAAAAAAA

RH42281.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG9542-RA 1332 CG9542-RA 267..1269 2..1004 5015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6486545..6487355 1003..193 3980 99.4 Minus
chr2L 23010047 chr2L 6487408..6487598 192..2 940 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:29:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6487561..6488372 1004..193 4060 100 Minus
2L 23513712 2L 6488425..6488615 192..2 955 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6487561..6488372 1004..193 4060 100 Minus
2L 23513712 2L 6488425..6488615 192..2 955 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:43:37 has no hits.

RH42281.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:44:39 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6486545..6487355 193..1003 99 <- Minus
chr2L 6487408..6487598 1..192 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:36 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
CG9542-RA 1..903 66..968 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:22 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
CG9542-RA 1..903 66..968 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:09:00 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
KFase-RA 1..903 66..968 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:53 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
CG9542-RA 1..903 66..968 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:47:54 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
KFase-RA 1..903 66..968 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:11 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
CG9542-RA 1..1002 2..1003 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:22 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
CG9542-RA 1..1002 2..1003 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:00 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
KFase-RA 1..1002 2..1003 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:53 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
CG9542-RA 1..1002 2..1003 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:47:54 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
KFase-RA 1..1002 2..1003 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:39 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6487562..6488372 193..1003 100 <- Minus
2L 6488425..6488615 1..192 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:39 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6487562..6488372 193..1003 100 <- Minus
2L 6488425..6488615 1..192 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:39 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6487562..6488372 193..1003 100 <- Minus
2L 6488425..6488615 1..192 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:00 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6488425..6488615 1..192 99   Minus
arm_2L 6487562..6488372 193..1003 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:37 Download gff for RH42281.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6487562..6488372 193..1003 100 <- Minus
2L 6488425..6488615 1..192 99   Minus

RH42281.pep Sequence

Translation from 65 to 967

> RH42281.pep
MYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEK
QGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCS
IVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSS
LTFAGHSAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLE
SVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIE
QSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEIE
*

RH42281.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15705-PA 299 GF15705-PA 1..298 1..298 1020 60.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23617-PA 300 GG23617-PA 1..300 1..300 1470 88.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13248-PA 307 GH13248-PA 1..299 1..294 919 55.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
KFase-PB 300 CG9542-PB 1..300 1..300 1590 100 Plus
KFase-PA 300 CG9542-PA 1..300 1..300 1590 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17287-PA 308 GI17287-PA 1..300 1..294 940 59 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26102-PA 302 GL26102-PA 1..299 1..297 1088 64.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21868-PA 302 GA21868-PA 1..299 1..297 1082 64.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17933-PA 300 GM17933-PA 1..300 1..300 1591 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22571-PA 288 GD22571-PA 1..288 1..300 1507 93 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17896-PA 321 GJ17896-PA 1..299 1..294 976 60.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18691-PA 308 GK18691-PA 3..305 1..296 896 54.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18436-PA 300 GE18436-PA 1..300 1..300 1469 87.7 Plus

RH42281.hyp Sequence

Translation from 65 to 967

> RH42281.hyp
MYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEK
QGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCS
IVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSS
LTFAGHSAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLE
SVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIE
QSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEIE
*

RH42281.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
KFase-PB 300 CG9542-PB 1..300 1..300 1590 100 Plus
KFase-PA 300 CG9542-PA 1..300 1..300 1590 100 Plus