Clone RH42446 Report

Search the DGRC for RH42446

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:424
Well:46
Vector:pFlc-1
Associated Gene/TranscriptCG42518-RB
Protein status:RH42446.pep: gold
Preliminary Size:599
Sequenced Size:827

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5134 2002-10-18 Blastp of sequenced clone
MED9 2008-04-29 Release 5.5 accounting
MED9 2008-08-15 Release 5.9 accounting
MED9 2008-12-18 5.12 accounting

Clone Sequence Records

RH42446.complete Sequence

827 bp (827 high quality bases) assembled on 2002-10-18

GenBank Submission: BT001821

> RH42446.complete
GATTACTTTGGTATTATTACGTGTTGTCGATCGAGGACAGAAAACCCATC
CTAACCGCCGACGGCCTGGTTCAGACTTCGAACTCCCCCTTCGAGCCGAC
CATATCGCAGGAGACGCAAACATCCAACGGAATCGGCGGCCAGTGCCATC
TGACGGTTGACCAGTTGGACATTGAGATTCTGCCGATAATCTACGACATT
GTGCGCTGCGTGGAAAAGGATCCTCTGGAGAACGCCGTTAAGCTGCGCGA
GTCCCAGGATTGCAACCACAAGATCTTTGAACTTCAAAAACGCTTCGAAT
CGGCACGCGAGCAAATCCGCCAGCTCCCCGGGATCGATTTCAATAAGGAG
GAGCAGCAACAGAGACTGGAACTACTGCGAAATCAGCTGAAGCTTAAGCA
GCAGCTAATTCGCAAATACAAGGACACAGAGTTCTAGGCGGCAGCAAAAT
AAAAAAAAGGGCAAGATGGTGCTGCGACTGCTAATGCGCTACCTGGCCAA
CAACGAGCAGCTCATCCAGCGCATGGCGGAGAGCTATCCCATGAGACGCG
CTGCCCAGTTGGTCGTTTCCCTGATGTACCGCACAAAAGACTTGGCCCGG
GAGCAGGGACTGCACGAGATGACGCCAGAGCGTTTCAAATCCTTCGTTAA
CATGTTTAAGAACAACGTGCGCCAAGAGCTGGAGGGAGTGAAGAAGGAGC
TTAATAGCAAGAAAAAGAACTAGGGTTCAGTAATTAACTTGTTTAACTAC
AATTGTATATACGCGGCAAGATAAATTTTAGTAAACACAGATGAATAAAC
ATTGAAGCCAGAAAAAAAAAAAAAAAA

RH42446.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG42518-RB 825 CG42518-RB 16..825 2..811 4050 100 Plus
CG42518-RA 844 CG42518-RA 62..844 29..811 3915 100 Plus
MED9-RC 849 MED9-RC 67..849 29..811 3915 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14054920..14055287 271..638 1840 100 Plus
chr2R 21145070 chr2R 14054492..14054671 29..208 900 100 Plus
chr2R 21145070 chr2R 14055357..14055529 639..811 820 98.3 Plus
chr2R 21145070 chr2R 14054806..14054870 208..272 325 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:29:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18167771..18168138 271..638 1840 100 Plus
2R 25286936 2R 18167343..18167522 29..208 900 100 Plus
2R 25286936 2R 18168208..18168382 639..813 875 100 Plus
2R 25286936 2R 18167657..18167721 208..272 325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18168970..18169337 271..638 1840 100 Plus
2R 25260384 2R 18168542..18168721 29..208 900 100 Plus
2R 25260384 2R 18169407..18169581 639..813 875 100 Plus
2R 25260384 2R 18168856..18168920 208..272 325 100 Plus
2R 25260384 2R 18168441..18168468 2..29 140 100 Plus
Blast to na_te.dros performed 2019-03-15 14:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6791..6907 341..459 121 59.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2432 352..458 120 61.8 Plus
roo 9092 roo DM_ROO 9092bp 1128..1210 352..436 114 61.2 Plus
roo 9092 roo DM_ROO 9092bp 1089..1150 346..407 112 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6810..6865 349..404 109 66.1 Plus

RH42446.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:35:53 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14054807..14054870 209..272 100 -> Plus
chr2R 14054389..14054418 1..29 96 -> Plus
chr2R 14054493..14054671 30..208 100 -> Plus
chr2R 14054922..14055287 273..638 100 -> Plus
chr2R 14055357..14055529 639..811 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:39 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 27..435 29..437 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:50:12 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 27..435 29..437 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:35:53 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 27..435 29..437 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:19 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 27..435 29..437 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:47 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 27..435 29..437 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:00:58 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 67..849 29..811 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:50:11 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
CG42518-RB 14..825 1..811 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:35:53 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
CG42518-RB 14..825 1..811 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:19 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 67..849 29..811 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:47 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
CG42518-RB 14..825 1..811 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:53 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18167240..18167269 1..29 96 -> Plus
2R 18167344..18167522 30..208 100 -> Plus
2R 18167658..18167721 209..272 100 -> Plus
2R 18167773..18168138 273..638 100 -> Plus
2R 18168208..18168380 639..811 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:53 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18167240..18167269 1..29 96 -> Plus
2R 18167344..18167522 30..208 100 -> Plus
2R 18167658..18167721 209..272 100 -> Plus
2R 18167773..18168138 273..638 100 -> Plus
2R 18168208..18168380 639..811 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:53 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18167240..18167269 1..29 96 -> Plus
2R 18167344..18167522 30..208 100 -> Plus
2R 18167658..18167721 209..272 100 -> Plus
2R 18167773..18168138 273..638 100 -> Plus
2R 18168208..18168380 639..811 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:35:53 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14055713..14055885 639..811 100   Plus
arm_2R 14054745..14054774 1..29 96 -> Plus
arm_2R 14054849..14055027 30..208 100 -> Plus
arm_2R 14055163..14055226 209..272 100 -> Plus
arm_2R 14055278..14055643 273..638 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:12:22 Download gff for RH42446.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18169407..18169579 639..811 100   Plus
2R 18168972..18169337 273..638 100 -> Plus
2R 18168439..18168468 1..29 96 -> Plus
2R 18168857..18168920 209..272 100 -> Plus
2R 18168543..18168721 30..208 100 -> Plus

RH42446.hyp Sequence

Translation from 0 to 436

> RH42446.hyp
ALLWYYYVLSIEDRKPILTADGLVQTSNSPFEPTISQETQTSNGIGGQCH
LTVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFE
SAREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKYKDTEF*

RH42446.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
MED9-PC 144 CG42517-PC 10..144 11..145 692 100 Plus

RH42446.pep Sequence

Translation from 465 to 722

> RH42446.pep
MVLRLLMRYLANNEQLIQRMAESYPMRRAAQLVVSLMYRTKDLAREQGLH
EMTPERFKSFVNMFKNNVRQELEGVKKELNSKKKN*

RH42446.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12139-PA 85 GF12139-PA 1..75 1..75 374 96 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21850-PA 230 GG21850-PA 146..230 1..85 414 92.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20127-PA 84 GH20127-PA 1..84 1..84 379 86.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42518-PB 85 CG42518-PB 1..85 1..85 424 100 Plus
CG42518-PA 85 CG5134-PB 1..85 1..85 424 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20217-PA 84 GI20217-PA 1..84 1..84 383 85.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11613-PA 84 GL11613-PA 1..83 1..83 392 90.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24792-PA 84 GA24792-PA 1..83 1..83 392 90.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21852-PA 229 GM21852-PA 145..229 1..85 430 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15439-PA 229 GD15439-PA 145..229 1..85 438 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20167-PA 85 GJ20167-PA 1..85 1..85 388 88.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10693-PA 84 GK10693-PA 1..84 1..84 376 82.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11931-PA 85 GE11931-PA 1..85 1..85 435 100 Plus