BDGP Sequence Production Resources |
Search the DGRC for RH42446
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 424 |
Well: | 46 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG42518-RB |
Protein status: | RH42446.pep: gold |
Preliminary Size: | 599 |
Sequenced Size: | 827 |
Gene | Date | Evidence |
---|---|---|
CG5134 | 2002-10-18 | Blastp of sequenced clone |
MED9 | 2008-04-29 | Release 5.5 accounting |
MED9 | 2008-08-15 | Release 5.9 accounting |
MED9 | 2008-12-18 | 5.12 accounting |
827 bp (827 high quality bases) assembled on 2002-10-18
GenBank Submission: BT001821
> RH42446.complete GATTACTTTGGTATTATTACGTGTTGTCGATCGAGGACAGAAAACCCATC CTAACCGCCGACGGCCTGGTTCAGACTTCGAACTCCCCCTTCGAGCCGAC CATATCGCAGGAGACGCAAACATCCAACGGAATCGGCGGCCAGTGCCATC TGACGGTTGACCAGTTGGACATTGAGATTCTGCCGATAATCTACGACATT GTGCGCTGCGTGGAAAAGGATCCTCTGGAGAACGCCGTTAAGCTGCGCGA GTCCCAGGATTGCAACCACAAGATCTTTGAACTTCAAAAACGCTTCGAAT CGGCACGCGAGCAAATCCGCCAGCTCCCCGGGATCGATTTCAATAAGGAG GAGCAGCAACAGAGACTGGAACTACTGCGAAATCAGCTGAAGCTTAAGCA GCAGCTAATTCGCAAATACAAGGACACAGAGTTCTAGGCGGCAGCAAAAT AAAAAAAAGGGCAAGATGGTGCTGCGACTGCTAATGCGCTACCTGGCCAA CAACGAGCAGCTCATCCAGCGCATGGCGGAGAGCTATCCCATGAGACGCG CTGCCCAGTTGGTCGTTTCCCTGATGTACCGCACAAAAGACTTGGCCCGG GAGCAGGGACTGCACGAGATGACGCCAGAGCGTTTCAAATCCTTCGTTAA CATGTTTAAGAACAACGTGCGCCAAGAGCTGGAGGGAGTGAAGAAGGAGC TTAATAGCAAGAAAAAGAACTAGGGTTCAGTAATTAACTTGTTTAACTAC AATTGTATATACGCGGCAAGATAAATTTTAGTAAACACAGATGAATAAAC ATTGAAGCCAGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 14054920..14055287 | 271..638 | 1840 | 100 | Plus |
chr2R | 21145070 | chr2R | 14054492..14054671 | 29..208 | 900 | 100 | Plus |
chr2R | 21145070 | chr2R | 14055357..14055529 | 639..811 | 820 | 98.3 | Plus |
chr2R | 21145070 | chr2R | 14054806..14054870 | 208..272 | 325 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 18167771..18168138 | 271..638 | 1840 | 100 | Plus |
2R | 25286936 | 2R | 18167343..18167522 | 29..208 | 900 | 100 | Plus |
2R | 25286936 | 2R | 18168208..18168382 | 639..813 | 875 | 100 | Plus |
2R | 25286936 | 2R | 18167657..18167721 | 208..272 | 325 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 18168970..18169337 | 271..638 | 1840 | 100 | Plus |
2R | 25260384 | 2R | 18168542..18168721 | 29..208 | 900 | 100 | Plus |
2R | 25260384 | 2R | 18169407..18169581 | 639..813 | 875 | 100 | Plus |
2R | 25260384 | 2R | 18168856..18168920 | 208..272 | 325 | 100 | Plus |
2R | 25260384 | 2R | 18168441..18168468 | 2..29 | 140 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6791..6907 | 341..459 | 121 | 59.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2326..2432 | 352..458 | 120 | 61.8 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1128..1210 | 352..436 | 114 | 61.2 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1089..1150 | 346..407 | 112 | 64.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6810..6865 | 349..404 | 109 | 66.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14054807..14054870 | 209..272 | 100 | -> | Plus |
chr2R | 14054389..14054418 | 1..29 | 96 | -> | Plus |
chr2R | 14054493..14054671 | 30..208 | 100 | -> | Plus |
chr2R | 14054922..14055287 | 273..638 | 100 | -> | Plus |
chr2R | 14055357..14055529 | 639..811 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 27..435 | 29..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 27..435 | 29..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 27..435 | 29..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 27..435 | 29..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 27..435 | 29..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 67..849 | 29..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42518-RB | 14..825 | 1..811 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42518-RB | 14..825 | 1..811 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 67..849 | 29..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42518-RB | 14..825 | 1..811 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18167240..18167269 | 1..29 | 96 | -> | Plus |
2R | 18167344..18167522 | 30..208 | 100 | -> | Plus |
2R | 18167658..18167721 | 209..272 | 100 | -> | Plus |
2R | 18167773..18168138 | 273..638 | 100 | -> | Plus |
2R | 18168208..18168380 | 639..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18167240..18167269 | 1..29 | 96 | -> | Plus |
2R | 18167344..18167522 | 30..208 | 100 | -> | Plus |
2R | 18167658..18167721 | 209..272 | 100 | -> | Plus |
2R | 18167773..18168138 | 273..638 | 100 | -> | Plus |
2R | 18168208..18168380 | 639..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18167240..18167269 | 1..29 | 96 | -> | Plus |
2R | 18167344..18167522 | 30..208 | 100 | -> | Plus |
2R | 18167658..18167721 | 209..272 | 100 | -> | Plus |
2R | 18167773..18168138 | 273..638 | 100 | -> | Plus |
2R | 18168208..18168380 | 639..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14055713..14055885 | 639..811 | 100 | Plus | |
arm_2R | 14054745..14054774 | 1..29 | 96 | -> | Plus |
arm_2R | 14054849..14055027 | 30..208 | 100 | -> | Plus |
arm_2R | 14055163..14055226 | 209..272 | 100 | -> | Plus |
arm_2R | 14055278..14055643 | 273..638 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18169407..18169579 | 639..811 | 100 | Plus | |
2R | 18168972..18169337 | 273..638 | 100 | -> | Plus |
2R | 18168439..18168468 | 1..29 | 96 | -> | Plus |
2R | 18168857..18168920 | 209..272 | 100 | -> | Plus |
2R | 18168543..18168721 | 30..208 | 100 | -> | Plus |
Translation from 0 to 436
> RH42446.hyp ALLWYYYVLSIEDRKPILTADGLVQTSNSPFEPTISQETQTSNGIGGQCH LTVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFE SAREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKYKDTEF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
MED9-PC | 144 | CG42517-PC | 10..144 | 11..145 | 692 | 100 | Plus |
Translation from 465 to 722
> RH42446.pep MVLRLLMRYLANNEQLIQRMAESYPMRRAAQLVVSLMYRTKDLAREQGLH EMTPERFKSFVNMFKNNVRQELEGVKKELNSKKKN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12139-PA | 85 | GF12139-PA | 1..75 | 1..75 | 374 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21850-PA | 230 | GG21850-PA | 146..230 | 1..85 | 414 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20127-PA | 84 | GH20127-PA | 1..84 | 1..84 | 379 | 86.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42518-PB | 85 | CG42518-PB | 1..85 | 1..85 | 424 | 100 | Plus |
CG42518-PA | 85 | CG5134-PB | 1..85 | 1..85 | 424 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20217-PA | 84 | GI20217-PA | 1..84 | 1..84 | 383 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11613-PA | 84 | GL11613-PA | 1..83 | 1..83 | 392 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24792-PA | 84 | GA24792-PA | 1..83 | 1..83 | 392 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21852-PA | 229 | GM21852-PA | 145..229 | 1..85 | 430 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15439-PA | 229 | GD15439-PA | 145..229 | 1..85 | 438 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20167-PA | 85 | GJ20167-PA | 1..85 | 1..85 | 388 | 88.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10693-PA | 84 | GK10693-PA | 1..84 | 1..84 | 376 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11931-PA | 85 | GE11931-PA | 1..85 | 1..85 | 435 | 100 | Plus |