Clone RH42520 Report

Search the DGRC for RH42520

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:425
Well:20
Vector:pFlc-1
Associated Gene/TranscriptCG9399-RA
Protein status:RH42520.pep: gold
Preliminary Size:697
Sequenced Size:1025

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9399 2002-01-01 Sim4 clustering to Release 2
CG9399 2002-04-26 Blastp of sequenced clone
CG9399 2003-01-01 Sim4 clustering to Release 3
CG9399 2008-04-29 Release 5.5 accounting
CG9399 2008-08-15 Release 5.9 accounting
CG9399 2008-12-18 5.12 accounting

Clone Sequence Records

RH42520.complete Sequence

1025 bp (1025 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113593

> RH42520.complete
GATTGGTAGCGATGCATTCGATTCAGACACATTTGCTTCCGTCAACATTT
TGCTGCGGAAATTGCGGAAATTGGCACACTCTCCTCAAGGTCAAGGATGT
TGTGCGATAGCTAATGAACCTGTGATCGTGCAAAAACCTGTTCCTAAAGA
TGAATGCATGATTTTTGCACTTTTTAGAAAGTCAACCAACGAGTTTGGAC
GCATAAATTATCATCACTGCAACCCGTGGAATTTTTTCGCACAAATAGCA
ACAACAACAAAATGTCGTCCACAGCCGTTCAGCCACCGCCGCCCGTTCCC
CCGCCGCCACCATCGGCCGTCCCTTCCGCCGGAAAGGGCATCCACTCCAA
GCTGTACAACGGGATGATTGGCGCCGCCGACAAATTTGTGCCCGCCAAGC
TGCGGCCACTGTGGATGCATCCAGCTGGTCCCAAGACGATATTCTTTTGG
GCACCCGTCTTCAAATGGGGTCTCGTTGCCGCCGGCCTGAGTGACTTGGC
CCGACCGGCCGACACCATCTCCGTGTCTGGATGCGCCGCCCTGGCTGCCA
CGGGCATCATCTGGTCGCGTTACTCGCTGGTGATCATACCCAAGAACTAC
AGCCTGTTCGCCGTGAATCTCTTCGTGGGCATCACGCAGGTGGTGCAGCT
GGCACGGGCCTACCACTACCACCAGAGTCAGGAGAAGCTGAAGCAGGAGC
AGCAGCAGCCGGCGGTGCAAAATTAGATACATATCGAATCGAATACCGGT
GCTGTCCCCTTTATATAGACTTTAATCGAACTTTTATGTACATACAAATC
CCACAACGCGCAACGTAAACGAAAGGATTAAGAGGAAGCTGTACTAGCAG
ATCGCGAAACTGCGTTTTACAACCTGTTAACCATTATTATTTATGGTTCA
CCGCCTTATCGACGTGATTCGTATTACTTAAGTTGTAACTGTGGAGGCTT
TGCGTATAGTTAAATCGAAACGAGAATGATAAATCAATACATTTTAAGAC
TTTAGTCACCAAAAAAAAAAAAAAA

RH42520.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG9399-RB 1237 CG9399-RB 19..1026 2..1009 5040 100 Plus
CG9399.k 1219 CG9399.k 1..1008 2..1009 5040 100 Plus
CG9399.j 2010 CG9399.j 780..1603 186..1009 4120 100 Plus
CG9399.j 2010 CG9399.j 389..572 2..185 920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5398061..5398602 1009..468 2710 100 Minus
chr3R 27901430 chr3R 5399199..5399442 429..186 1220 100 Minus
chr3R 27901430 chr3R 5399650..5399833 185..2 920 100 Minus
chr3R 27901430 chr3R 5396438..5396508 627..557 250 90.1 Minus
chr3R 27901430 chr3R 5399095..5399137 469..427 215 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:29:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9572214..9572755 1009..468 2710 100 Minus
3R 32079331 3R 9573352..9573595 429..186 1220 100 Minus
3R 32079331 3R 9573803..9573986 185..2 920 100 Minus
3R 32079331 3R 9570591..9570661 627..557 250 90.1 Minus
3R 32079331 3R 9573248..9573290 469..427 215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9313045..9313586 1009..468 2710 100 Minus
3R 31820162 3R 9314183..9314426 429..186 1220 100 Minus
3R 31820162 3R 9314634..9314817 185..2 920 100 Minus
3R 31820162 3R 9311422..9311492 627..557 250 90.1 Minus
3R 31820162 3R 9314079..9314121 469..427 215 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:46:02 has no hits.

RH42520.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:46:42 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5399201..5399442 186..427 100 <- Minus
chr3R 5399650..5399833 1..185 99   Minus
chr3R 5399096..5399136 428..468 100 <- Minus
chr3R 5398060..5398601 469..1010 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:42 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RA 1..465 262..726 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:47 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RC 1..465 262..726 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:24:16 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RB 1..465 262..726 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:15 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RA 1..465 262..726 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:58:48 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RB 1..465 262..726 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:44 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RB 1..1008 2..1010 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:47 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RB 1..1008 2..1009 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:24:16 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RB 1..1008 2..1009 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:15 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RB 1..1008 2..1010 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:58:48 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9399-RB 1..1008 2..1009 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:42 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9572213..9572754 469..1010 99 <- Minus
3R 9573249..9573289 428..468 100 <- Minus
3R 9573354..9573595 186..427 100 <- Minus
3R 9573803..9573986 1..185 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:42 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9572213..9572754 469..1010 99 <- Minus
3R 9573249..9573289 428..468 100 <- Minus
3R 9573354..9573595 186..427 100 <- Minus
3R 9573803..9573986 1..185 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:42 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9572213..9572754 469..1010 99 <- Minus
3R 9573249..9573289 428..468 100 <- Minus
3R 9573354..9573595 186..427 100 <- Minus
3R 9573803..9573986 1..185 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:24:16 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5397935..5398476 469..1010 99 <- Minus
arm_3R 5398971..5399011 428..468 100 <- Minus
arm_3R 5399076..5399317 186..427 100 <- Minus
arm_3R 5399525..5399708 1..185 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:54 Download gff for RH42520.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9313044..9313585 469..1010 99 <- Minus
3R 9314080..9314120 428..468 100 <- Minus
3R 9314185..9314426 186..427 100 <- Minus
3R 9314634..9314817 1..185 99   Minus

RH42520.pep Sequence

Translation from 261 to 725

> RH42520.pep
MSSTAVQPPPPVPPPPPSAVPSAGKGIHSKLYNGMIGAADKFVPAKLRPL
WMHPAGPKTIFFWAPVFKWGLVAAGLSDLARPADTISVSGCAALAATGII
WSRYSLVIIPKNYSLFAVNLFVGITQVVQLARAYHYHQSQEKLKQEQQQP
AVQN*

RH42520.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16532-PA 156 GF16532-PA 26..154 24..152 605 86.8 Plus
Dana\GF16533-PA 150 GF16533-PA 7..146 14..153 553 71.4 Plus
Dana\GF14537-PA 140 GF14537-PA 2..123 22..142 344 55.7 Plus
Dana\GF15117-PA 143 GF15117-PA 6..122 30..148 262 43.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17356-PA 154 GG17356-PA 1..154 1..154 776 96.8 Plus
Dere\GG17358-PA 152 GG17358-PA 18..149 24..153 502 68.9 Plus
Dere\GG21765-PA 140 GG21765-PA 2..123 22..142 337 55.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19299-PA 156 GH19299-PA 25..138 24..137 562 89.5 Plus
Dgri\GH13770-PA 140 GH13770-PA 2..133 22..150 320 50.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG9399-PD 154 CG9399-PD 1..154 1..154 813 100 Plus
CG9399-PA 154 CG9399-PA 1..154 1..154 813 100 Plus
CG9399-PB 154 CG9399-PB 1..154 1..154 813 100 Plus
CG9399-PE 120 CG9399-PE 1..120 35..154 627 100 Plus
CG9396-PA 151 CG9396-PA 5..148 11..153 518 66.7 Plus
CG32832-PB 140 CG32832-PB 2..107 22..126 338 61.3 Plus
CG32832-PA 140 CG32832-PA 2..107 22..126 338 61.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23515-PA 154 GI23515-PA 23..148 24..149 577 81 Plus
Dmoj\GI17910-PA 140 GI17910-PA 2..123 22..142 335 54.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21494-PA 155 GL21494-PA 1..149 1..149 596 84.6 Plus
Dper\GL21495-PA 149 GL21495-PA 1..146 12..152 515 68.5 Plus
Dper\GL19324-PA 140 GL19324-PA 2..124 22..145 349 57.6 Plus
Dper\GL16074-PA 141 GL16074-PA 3..110 27..133 234 47.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26297-PA 155 GA26297-PA 1..149 1..149 596 84.6 Plus
Dpse\GA26298-PA 149 GA26298-PA 1..146 12..152 515 68.5 Plus
Dpse\GA25919-PA 140 GA25919-PA 2..124 22..145 349 57.6 Plus
Dpse\GA26115-PA 141 GA26115-PA 3..110 27..133 234 47.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26242-PA 154 GM26242-PA 1..154 1..154 793 99.4 Plus
Dsec\GM26243-PA 151 GM26243-PA 16..148 22..153 493 69.2 Plus
Dsec\GM17149-PA 140 GM17149-PA 2..123 22..142 336 54.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20782-PA 154 GD20782-PA 1..154 1..154 786 98.7 Plus
Dsim\GD20783-PA 151 GD20783-PA 16..148 22..153 502 69.9 Plus
Dsim\GD21889-PA 140 GD21889-PA 2..123 22..142 336 54.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10267-PA 157 GJ10267-PA 1..155 1..152 614 82.6 Plus
Dvir\GJ17418-PA 141 GJ17418-PA 2..123 22..142 325 54.1 Plus
Dvir\GJ17419-PA 126 GJ17419-PA 2..123 22..142 313 52.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11250-PA 154 GK11250-PA 21..146 24..149 621 92.1 Plus
Dwil\GK11251-PA 141 GK11251-PA 12..135 26..149 519 75.8 Plus
Dwil\GK18148-PA 91 GK18148-PA 6..87 26..106 276 63.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24761-PA 152 GE24761-PA 1..152 1..154 756 96.1 Plus
Dyak\GE24762-PA 152 GE24762-PA 18..149 24..153 502 68.9 Plus
Dyak\GE13155-PA 140 GE13155-PA 2..123 22..142 345 54.9 Plus

RH42520.hyp Sequence

Translation from 261 to 725

> RH42520.hyp
MSSTAVQPPPPVPPPPPSAVPSAGKGIHSKLYNGMIGAADKFVPAKLRPL
WMHPAGPKTIFFWAPVFKWGLVAAGLSDLARPADTISVSGCAALAATGII
WSRYSLVIIPKNYSLFAVNLFVGITQVVQLARAYHYHQSQEKLKQEQQQP
AVQN*

RH42520.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9399-PD 154 CG9399-PD 1..154 1..154 813 100 Plus
CG9399-PA 154 CG9399-PA 1..154 1..154 813 100 Plus
CG9399-PB 154 CG9399-PB 1..154 1..154 813 100 Plus
CG9399-PE 120 CG9399-PE 1..120 35..154 627 100 Plus
CG9396-PA 151 CG9396-PA 5..148 11..153 518 66.7 Plus