Clone RH43234 Report

Search the DGRC for RH43234

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:432
Well:34
Vector:pFlc-1
Associated Gene/TranscriptCG2650-RA
Protein status:RH43234.pep: gold
Preliminary Size:795
Sequenced Size:1032

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2650 2001-12-17 Blastp of sequenced clone
CG2650 2002-01-01 Sim4 clustering to Release 2
CG2650 2003-01-01 Sim4 clustering to Release 3
CG2650 2008-04-29 Release 5.5 accounting
CG2650 2008-08-15 Release 5.9 accounting
CG2650 2008-12-18 5.12 accounting

Clone Sequence Records

RH43234.complete Sequence

1032 bp (1032 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071726

> RH43234.complete
GAGTCAGTTGTCGCTTAGCTAAATCGCCATACAGAGATTACGGACTACGG
ACTACGGAACACGGAAAAATGCAGCTAACCGGTGCCTCTATGTTCCTCGT
ATGGGTGGGTCTACTCAGCTGGGTTTCCTGCAGAGTGGACGCCTCCGAAG
GATTTCCATCGCCGCTGAAGCGCTGCAAGCTCCAGGATGAGTCGTGCTTG
CTGGCTCAGGCGCAAACCTTTTTCCAAGCCTTCAAGAATGGCATTCCGGA
GCGGCAGGTGGCCGCGCTGGAGCCCATTGCCCTGGGCACGATGTTCATCG
AGAGCGGCGGCCACTCGGAGTCGATAAAGTTCAAACTGACCATGAGCGAT
GCCAAGCTCTACAATCTGGCCAACTCGATGATGGTCAAGAGCCTGAAGGG
ATTCACCAAGGACCTCACCAGGCCGCTCAAGCTGACCCTGCTCTTGGACA
ATCCGGAACTGGAGGTGCGGGCCAAGTACGACGTAGACGGCAAGCTGCTC
ATCCTGCCCATTGTCAGCAAGGGCGACCTGACCATTCGGTTGAACGATGT
GCACACAAAGGTTTGGATTACCGCCGAGCCAGTGAAGCGCTCCGATGGCC
ACACCTATCTCAACATCACCGACTACAAGACGGCCACCAAGATCAAGGGT
GGCCACTTTGACCTGTCGAATCTGTTCAACGACAACAAGGAGCTGCGCGA
CAGCACGCTGAAGGTGCTGAACCAGGAGTGGAGCACCCTGGCCCTCGATG
TCCAGCCGAAGATCAACGAGGCCTGCGCCAAGGCCTTCAGTGCCATCGTA
CAGAGTCTGTGGGCCAACATTCCCTACGACGAGTTCTTCGAAAAGGAATG
AACGCATATGTATCTAACAAAGTCCGGTCTAACTAGCCACTCTAGCTAAT
TACTGATTAAACTACCTAATTGCAGCTAAATCCAATCCATCTTCGATTAA
AACAACTACTACAAGTGTTGGCGTTGGCTTTTCGATATTTATTGTACAAT
AAATAACTAAAAAAGACAAAAAAAAAAAAAAA

RH43234.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG2650-RA 1133 CG2650-RA 120..1133 3..1016 5070 100 Plus
per.a 4441 per.a 4392..4441 1016..967 250 100 Minus
per-RA 4527 per-RA 4478..4527 1016..967 250 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2586972..2587464 649..157 2465 100 Minus
chrX 22417052 chrX 2586547..2586914 1016..649 1840 100 Minus
chrX 22417052 chrX 2587549..2587702 156..3 770 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:29:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2693156..2693648 649..157 2465 100 Minus
X 23542271 X 2692731..2693098 1016..649 1840 100 Minus
X 23542271 X 2693733..2693886 156..3 770 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2701254..2701746 649..157 2465 100 Minus
X 23527363 X 2700829..2701196 1016..649 1840 100 Minus
X 23527363 X 2701831..2701984 156..3 770 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:35:06 has no hits.

RH43234.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:35:56 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2586546..2586913 650..1017 99 <- Minus
chrX 2586972..2587464 157..649 100 <- Minus
chrX 2587549..2587702 1..156 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:46:54 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..783 69..851 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:34 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..783 69..851 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:36:00 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..783 69..851 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:13 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..783 69..851 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:55 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..783 69..851 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:38 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..1014 3..1016 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:34 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..1014 3..1016 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:36:00 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..1013 3..1015 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:14 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..1014 3..1016 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:55 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
CG2650-RA 1..1013 3..1015 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:56 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
X 2692730..2693097 650..1017 99 <- Minus
X 2693156..2693648 157..649 100 <- Minus
X 2693733..2693886 1..156 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:56 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
X 2692730..2693097 650..1017 99 <- Minus
X 2693156..2693648 157..649 100 <- Minus
X 2693733..2693886 1..156 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:56 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
X 2692730..2693097 650..1017 99 <- Minus
X 2693156..2693648 157..649 100 <- Minus
X 2693733..2693886 1..156 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:36:00 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2586763..2587130 650..1017 99 <- Minus
arm_X 2587189..2587681 157..649 100 <- Minus
arm_X 2587766..2587919 1..156 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:39 Download gff for RH43234.complete
Subject Subject Range Query Range Percent Splice Strand
X 2700828..2701195 650..1017 99 <- Minus
X 2701254..2701746 157..649 100 <- Minus
X 2701831..2701984 1..156 98   Minus

RH43234.hyp Sequence

Translation from 2 to 850

> RH43234.hyp
VSCRLAKSPYRDYGLRTTEHGKMQLTGASMFLVWVGLLSWVSCRVDASEG
FPSPLKRCKLQDESCLLAQAQTFFQAFKNGIPERQVAALEPIALGTMFIE
SGGHSESIKFKLTMSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDN
PELEVRAKYDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGH
TYLNITDYKTATKIKGGHFDLSNLFNDNKELRDSTLKVLNQEWSTLALDV
QPKINEACAKAFSAIVQSLWANIPYDEFFEKE*

RH43234.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG2650-PA 260 CG2650-PA 1..260 23..282 1341 100 Plus
to-PB 249 CG11853-PB 1..248 30..282 294 29.5 Plus
to-PA 249 CG11853-PA 1..248 30..282 294 29.5 Plus
CG11854-PB 250 CG11854-PB 23..248 51..279 288 29.1 Plus
CG11852-PA 250 CG11852-PA 1..247 30..279 243 26.6 Plus

RH43234.pep Sequence

Translation from 68 to 850

> RH43234.pep
MQLTGASMFLVWVGLLSWVSCRVDASEGFPSPLKRCKLQDESCLLAQAQT
FFQAFKNGIPERQVAALEPIALGTMFIESGGHSESIKFKLTMSDAKLYNL
ANSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAKYDVDGKLLILPIVS
KGDLTIRLNDVHTKVWITAEPVKRSDGHTYLNITDYKTATKIKGGHFDLS
NLFNDNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWAN
IPYDEFFEKE*

RH43234.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21371-PA 263 GF21371-PA 1..263 1..260 902 63.1 Plus
Dana\GF17554-PA 254 GF17554-PA 12..250 20..257 308 29.6 Plus
Dana\GF17553-PA 248 GF17553-PA 5..248 15..260 253 28.2 Plus
Dana\GF17552-PA 250 GF17552-PA 6..250 10..260 235 26.5 Plus
Dana\GF20756-PA 251 GF20756-PA 21..249 19..257 211 24.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18615-PA 260 GG18615-PA 1..260 1..260 1043 78.1 Plus
Dere\GG11380-PA 250 GG11380-PA 1..248 1..257 314 29.5 Plus
Dere\GG11379-PA 248 GG11379-PA 6..245 16..257 291 29.1 Plus
Dere\GG11378-PA 250 GG11378-PA 1..247 8..257 246 27 Plus
Dere\GG16269-PA 272 GG16269-PA 30..253 30..256 214 26 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12677-PA 257 GH12677-PA 8..256 10..258 628 46.2 Plus
Dgri\GH17381-PA 246 GH17381-PA 20..244 29..257 249 26.8 Plus
Dgri\GH14735-PA 237 GH14735-PA 20..235 29..257 234 24.9 Plus
Dgri\GH17380-PA 248 GH17380-PA 16..245 25..257 231 27.4 Plus
Dgri\GH17382-PA 259 GH17382-PA 21..250 24..257 227 25.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG2650-PA 260 CG2650-PA 1..260 1..260 1341 100 Plus
to-PB 249 CG11853-PB 1..248 8..260 294 29.5 Plus
to-PA 249 CG11853-PA 1..248 8..260 294 29.5 Plus
CG11854-PB 250 CG11854-PB 23..248 29..257 288 29.1 Plus
CG11852-PA 250 CG11852-PA 1..247 8..257 243 26.6 Plus
CG14457-PC 270 CG14457-PC 10..251 15..256 233 26.9 Plus
CG14457-PB 271 CG14457-PB 10..252 15..256 233 26.8 Plus
CG17279-PD 245 CG17279-PD 20..243 30..257 231 25.4 Plus
CG10407-PB 259 CG10407-PB 6..255 3..255 221 24.8 Plus
CG10407-PA 259 CG10407-PA 6..255 3..255 221 24.8 Plus
CG10407-PC 263 CG10407-PC 6..259 3..255 209 24.4 Plus
CG10264-PA 270 CG10264-PA 45..264 30..252 206 27.6 Plus
CG13618-PA 252 CG13618-PA 22..250 23..257 204 23.4 Plus
CG1124-PA 246 CG1124-PA 22..244 30..257 185 23.8 Plus
CG14661-PB 246 CG14661-PB 4..244 2..257 172 24.5 Plus
CG14661-PA 246 CG14661-PA 4..244 2..257 172 24.5 Plus
CG5945-PB 250 CG5945-PB 5..250 13..259 168 23.2 Plus
CG5945-PA 250 CG5945-PA 5..250 13..259 168 23.2 Plus
CG2016-PD 249 CG2016-PD 1..245 3..256 158 20.6 Plus
CG2016-PB 249 CG2016-PB 1..245 3..256 158 20.6 Plus
CG7079-PB 255 CG7079-PB 23..248 30..257 151 21.7 Plus
CG7079-PA 255 CG7079-PA 23..248 30..257 151 21.7 Plus
CG2016-PE 254 CG2016-PE 1..250 3..256 148 20.6 Plus
CG14259-PA 289 CG14259-PA 7..270 5..258 148 22.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16254-PA 228 GI16254-PA 1..228 33..260 686 53.1 Plus
Dmoj\GI23926-PA 238 GI23926-PA 3..235 20..257 289 30.1 Plus
Dmoj\GI23925-PA 241 GI23925-PA 5..241 15..259 280 30.8 Plus
Dmoj\GI13915-PA 271 GI13915-PA 29..252 30..256 223 26.4 Plus
Dmoj\GI23924-PA 255 GI23924-PA 12..255 20..260 215 25.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18241-PA 270 GL18241-PA 3..257 9..260 867 62.5 Plus
Dper\GL11989-PA 256 GL11989-PA 20..254 19..257 288 28.3 Plus
Dper\GL11987-PA 250 GL11987-PA 1..247 8..257 244 26.6 Plus
Dper\GL11988-PA 251 GL11988-PA 5..248 15..260 235 25 Plus
Dper\GL12686-PA 243 GL12686-PA 17..243 26..259 231 24.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15409-PA 268 GA15409-PA 3..255 9..260 872 63 Plus
Dpse\GA11238-PA 256 GA11238-PA 20..254 19..257 288 28.3 Plus
Dpse\GA11236-PA 250 GA11236-PA 1..247 8..257 244 26.6 Plus
Dpse\GA11237-PA 251 GA11237-PA 5..248 15..260 235 25 Plus
Dpse\GA27589-PA 227 GA27589-PA 3..227 29..259 226 25.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18865-PA 260 GM18865-PA 1..260 1..260 1286 92.3 Plus
Dsec\GM17822-PA 249 GM17822-PA 1..248 8..260 299 28.7 Plus
Dsec\GM17823-PA 246 GM17823-PA 23..244 29..257 265 27.8 Plus
Dsec\GM17820-PA 250 GM17820-PA 1..247 8..257 250 26.2 Plus
Dsec\GM22460-PA 273 GM22460-PA 4..254 6..256 242 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24605-PA 260 GD24605-PA 1..260 1..260 1305 93.1 Plus
Dsim\GD21191-PA 250 GD21191-PA 23..248 29..257 301 29.6 Plus
Dsim\GD21190-PA 241 GD21190-PA 21..240 38..260 277 29 Plus
Dsim\GD21189-PA 250 GD21189-PA 1..247 8..257 251 26.2 Plus
Dsim\GD15043-PA 271 GD15043-PA 8..252 13..256 242 27 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16719-PA 257 GJ16719-PA 23..256 25..258 693 52.6 Plus
Dvir\GJ24020-PA 255 GJ24020-PA 13..252 19..257 261 25.4 Plus
Dvir\GJ24018-PA 246 GJ24018-PA 9..246 19..259 260 28.4 Plus
Dvir\GJ24016-PA 251 GJ24016-PA 9..248 15..257 226 26.7 Plus
Dvir\GJ24019-PA 245 GJ24019-PA 2..245 7..259 223 26 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19974-PA 256 GK19974-PA 10..255 8..258 772 56.6 Plus
Dwil\GK13452-PA 254 GK13452-PA 2..251 3..257 276 26.2 Plus
Dwil\GK13450-PA 250 GK13450-PA 1..247 8..257 249 26.6 Plus
Dwil\GK16767-PA 272 GK16767-PA 2..253 7..256 224 24.7 Plus
Dwil\GK13451-PA 244 GK13451-PA 5..242 10..252 220 28.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16930-PA 260 GE16930-PA 1..260 1..260 1154 86.2 Plus
Dyak\GE23577-PA 250 GE23577-PA 1..248 1..257 301 29.1 Plus
Dyak\to-PA 248 GE23576-PA 6..248 16..260 297 29.1 Plus
Dyak\GE23575-PA 251 GE23575-PA 2..248 8..257 239 26.2 Plus
Dyak\GE22627-PA 271 GE22627-PA 8..252 13..256 229 26.2 Plus