Clone RH43654 Report

Search the DGRC for RH43654

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:436
Well:54
Vector:pFlc-1
Associated Gene/TranscriptmRpL9-RA
Protein status:RH43654.pep: gold
Preliminary Size:1065
Sequenced Size:805

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4923 2002-01-01 Sim4 clustering to Release 2
CG31478 2002-05-21 Blastp of sequenced clone
CG31478 2003-01-01 Sim4 clustering to Release 3
mRpL9 2008-04-29 Release 5.5 accounting
mRpL9 2008-08-15 Release 5.9 accounting
mRpL9 2008-12-18 5.12 accounting

Clone Sequence Records

RH43654.complete Sequence

805 bp (805 high quality bases) assembled on 2002-05-21

GenBank Submission: AY118435

> RH43654.complete
GATTGGTGGTAAAAATGTTGAAGAACATCTACGTAACGCCGTTAAATTTG
CTTAAATCGGCCACCAGCCTGCAGCAGCAAGTGCGGACCACGTTCGTCCT
GAAGCGCAAATATGACCCGCCGCTGCACAAAACCAACGAGAAACCCCGCC
GGATGAGGGCCAAGAACTTCATCTACGAGCTCGTGGACGACACGCTGGTC
AAAAAGCGGCCCAACATCGAGGTGGTGCTAAAGACCTTCGTCGAGGGCGT
TGGCGACAAGGGCGACGTGGTGTCAATGAAGCCGCACTTTGTCTACAATA
AGCTCCTGCTGCCGGGTTTGGCCGCGTACAATACGCCGGAGAATGTGGCC
AAGTACGCCAAGACAGAGGCTGAAAAATCGACTGTTAAACACAGCTCCCC
CTACGCCCAGCGCACGGTCAACATGCTGGAGACCATTGTGCTGGCGGTGG
TCATGAACAAGGATGAGCCATGGGTGCTCGAGCCCTGGCACATCAAGGCC
TCGCTGCGCAAGACTGGGTTCTATTGTCGCGAGGAGTGCATTACCCTGCC
CAAGGAGCGCATCGAGGGACCCGACCTGAAGAAGGAGAACAAGGACTTCT
ACTGCACTGTGACCATAAACAAGCTGGAACAGGCGCGACTCAAGTGTCGT
CTGCACCACTGGAGCACAGATCCCAGCGAACGGCTGCCTTACGTACTCGA
GCACTGGAAACTCCAGTCTGAGCCCCTGCTGGATGTATGTTCACCCGAAA
AAACCCCTTAGAGACCCCATACCAAATACATGCGATTGTTACAAAAAAAA
AAAAA

RH43654.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL9-RA 897 mRpL9-RA 76..870 2..796 3975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11155508..11156214 86..792 3535 100 Plus
chr3R 27901430 chr3R 11155367..11155451 2..86 425 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:29:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15330882..15331592 86..796 3555 100 Plus
3R 32079331 3R 15330741..15330825 2..86 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15071713..15072423 86..796 3555 100 Plus
3R 31820162 3R 15071572..15071656 2..86 425 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:51:24 has no hits.

RH43654.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:52:37 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11155366..11155451 1..86 98 -> Plus
chr3R 11155509..11156214 87..792 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:08 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 1..747 15..761 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:33 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 1..747 15..761 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:05 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 1..747 15..761 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:33 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 1..747 15..761 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:56:50 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 1..747 15..761 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:23 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 2..792 2..792 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:33 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 2..792 2..792 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:05 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 3..794 1..792 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:33 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 2..792 2..792 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:56:50 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL9-RA 3..794 1..792 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:37 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15330740..15330825 1..86 98 -> Plus
3R 15330883..15331588 87..792 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:37 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15330740..15330825 1..86 98 -> Plus
3R 15330883..15331588 87..792 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:37 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15330740..15330825 1..86 98 -> Plus
3R 15330883..15331588 87..792 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:05 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11156462..11156547 1..86 98 -> Plus
arm_3R 11156605..11157310 87..792 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:26 Download gff for RH43654.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15071714..15072419 87..792 100   Plus
3R 15071571..15071656 1..86 98 -> Plus

RH43654.hyp Sequence

Translation from 2 to 760

> RH43654.hyp
LVVKMLKNIYVTPLNLLKSATSLQQQVRTTFVLKRKYDPPLHKTNEKPRR
MRAKNFIYELVDDTLVKKRPNIEVVLKTFVEGVGDKGDVVSMKPHFVYNK
LLLPGLAAYNTPENVAKYAKTEAEKSTVKHSSPYAQRTVNMLETIVLAVV
MNKDEPWVLEPWHIKASLRKTGFYCREECITLPKERIEGPDLKKENKDFY
CTVTINKLEQARLKCRLHHWSTDPSERLPYVLEHWKLQSEPLLDVCSPEK
TP*

RH43654.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL9-PA 248 CG31478-PA 1..248 5..252 1315 100 Plus

RH43654.pep Sequence

Translation from 14 to 760

> RH43654.pep
MLKNIYVTPLNLLKSATSLQQQVRTTFVLKRKYDPPLHKTNEKPRRMRAK
NFIYELVDDTLVKKRPNIEVVLKTFVEGVGDKGDVVSMKPHFVYNKLLLP
GLAAYNTPENVAKYAKTEAEKSTVKHSSPYAQRTVNMLETIVLAVVMNKD
EPWVLEPWHIKASLRKTGFYCREECITLPKERIEGPDLKKENKDFYCTVT
INKLEQARLKCRLHHWSTDPSERLPYVLEHWKLQSEPLLDVCSPEKTP*

RH43654.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23199-PA 252 GF23199-PA 1..248 1..248 1231 91.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16914-PA 248 GG16914-PA 1..246 1..246 1249 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19122-PA 253 GH19122-PA 1..245 1..245 1120 84.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL9-PA 248 CG31478-PA 1..248 1..248 1315 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10854-PA 257 GI10854-PA 1..245 1..245 1084 81.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23242-PA 251 GL23242-PA 1..246 1..246 1186 89.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16276-PA 251 GA16276-PA 1..246 1..246 1185 89.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24221-PA 248 GM24221-PA 1..246 1..246 1262 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19012-PA 248 GD19012-PA 1..246 1..246 1263 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14462-PA 256 GJ14462-PA 1..245 1..245 1165 88.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11133-PA 251 GK11133-PA 1..246 1..244 1116 85 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24297-PA 248 GE24297-PA 1..247 1..247 1258 94.7 Plus