Clone RH44312 Report

Search the DGRC for RH44312

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:443
Well:12
Vector:pFlc-1
Associated Gene/TranscriptmRpS9-RA
Protein status:RH44312.pep: gold
Preliminary Size:974
Sequenced Size:1313

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2957 2002-01-01 Sim4 clustering to Release 2
CG2957 2002-02-27 Blastp of sequenced clone
CG2957 2003-01-01 Sim4 clustering to Release 3
mRpS9 2008-04-29 Release 5.5 accounting
mRpS9 2008-08-15 Release 5.9 accounting
mRpS9 2008-12-18 5.12 accounting

Clone Sequence Records

RH44312.complete Sequence

1313 bp (1313 high quality bases) assembled on 2002-02-27

GenBank Submission: AY089671

> RH44312.complete
CACCTCTTCTTCTTCCGCAAAATTGAAAGGATGGCACTGCGTGTTTTTGG
CTTAAATATAGTAAAAAATAACAGGAATCTGCTGCAAAATGCATGCAAAT
CCAGGGCACCGATGCCATGCTACATGGCAGCGGCTCCATTTGCCACCGAT
GTGACCGTCCAGGCTGCTCCGGCGGCTGTCCAGAAGCAAAGGGTGAGCAA
GGCCATGCGGGCGTACCTGAAAAGAGCCACCGAACACGACGAGTTCATGA
AGACCCAGCACCTGGAGTTCCAGATCGGAAAGCGGCACCTGGCCAACATG
ATGGGCGCCGATGCGGAGACGTTTACCCAGGAGGACATAGACGAGGCGAT
ATCCTATCTGTTCCCTTCCGGATTGTACGACCAAAAGGCCCGGCCGGCTA
TGAAGTCACCCGAGGTTGTCTTCCCCGCCCGCAAGGCTGCGGAATTCGAT
GAGACGGGCAGACCATTCCACAGCATGTTCTACACCGGCAAACCCAACTT
CTTCCAACTGCTTCATGACATTGTAGAAGAAACTAACAAGCTGGCGGATC
TGGAGGAGCGCATGCTACGGCGCGGCAATAAACCCGATGAGAACCAAAAA
CTTGAGATTGCCGGCTTTCAGCTGCTGCCCAAGGACCAGTTGGAACTTTT
GCTAGTTGAGAGCATTGCCGATATCGAATACTCCAACTTTACCAACTCCA
TGGATCGCCTGATCGCATCGCCATATGCTTACAAGAGCAAAGCATTCATC
GAGCGATACATGAAACCGCTGATGGACCAGTCCAAGCAGCTGGAGGTGCC
CAAACCAAGGATCGATGAAGAGGGTCGCCAGTACATCACCACCTACGAGT
GCCTGCGCAAAACTGCTAGAGCCGATGTCACAGTGCGGCTACCCGGAACA
GGAAAAATCAGCATTAATGGAAAGGATATCTCATACTTTGAGGACGAAAA
CTGCAGAGAACAGCTGCTCTTCCCGCTGCAATTTAGCGAGCTGCTGGGCA
AAGTCGATGTGGAGGCCAACGTCGAGGGAGGCGGACCTTCCGGTCAGGCT
GGAGCCATCCGCTGGGGCATCGCCATGAGTTTGCGCAGCTTTGTCGATCA
AGAGATGATTGAGTCAATGCGTCTGGCCGGCCTGCTGACACGTGACTATC
GCCGTCGGGAGCGTAAGAAGTTCGGGCAGGAAGGAGCACGCCGCAAGTAC
ACGTGGAAGAAGCGCTAGACGGGCACGTGCATCTGCAACACTAGGCTGCA
TTTTATAGCGAAGTGTTTTAATAAATATAAATTGTGTTAAAAAAAAAGAA
AAAAAAAAAAAAA

RH44312.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS9-RA 1340 mRpS9-RA 40..1326 4..1290 6435 100 Plus
CG10092.a 2002 CG10092.a 1849..2002 1290..1137 770 100 Minus
CG10092-RA 1943 CG10092-RA 1882..1943 1290..1229 310 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3727419..3727779 963..603 1805 100 Minus
chr3R 27901430 chr3R 3728273..3728490 343..126 1090 100 Minus
chr3R 27901430 chr3R 3728041..3728215 517..343 875 100 Minus
chr3R 27901430 chr3R 3715531..3715696 1126..961 830 100 Minus
chr3R 27901430 chr3R 3715297..3715461 1290..1126 825 100 Minus
chr3R 27901430 chr3R 3728571..3728694 127..4 620 100 Minus
chr3R 27901430 chr3R 3727845..3727930 602..517 430 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7901384..7901744 963..603 1805 100 Minus
3R 32079331 3R 7902238..7902455 343..126 1090 100 Minus
3R 32079331 3R 7902006..7902180 517..343 875 100 Minus
3R 32079331 3R 7889509..7889674 1126..961 830 100 Minus
3R 32079331 3R 7889275..7889439 1290..1126 825 100 Minus
3R 32079331 3R 7902536..7902659 127..4 620 100 Minus
3R 32079331 3R 7901810..7901895 602..517 430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7642215..7642575 963..603 1805 100 Minus
3R 31820162 3R 7643069..7643286 343..126 1090 100 Minus
3R 31820162 3R 7642837..7643011 517..343 875 100 Minus
3R 31820162 3R 7630340..7630505 1126..961 830 100 Minus
3R 31820162 3R 7630106..7630270 1290..1126 825 100 Minus
3R 31820162 3R 7643367..7643490 127..4 620 100 Minus
3R 31820162 3R 7642641..7642726 602..517 430 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:25:39 has no hits.

RH44312.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:26:36 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3715297..3715460 1127..1290 100 <- Minus
chr3R 3715531..3715693 964..1126 100 <- Minus
chr3R 3727419..3727779 603..963 100 <- Minus
chr3R 3727845..3727930 517..602 100 <- Minus
chr3R 3728042..3728215 343..516 100 <- Minus
chr3R 3728274..3728489 127..342 100 <- Minus
chr3R 3728572..3728694 1..126 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:58:41 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 1..1188 31..1218 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:32:26 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 1..1188 31..1218 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:29:28 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 1..1188 31..1218 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:05:19 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 1..1188 31..1218 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:39:22 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 1..1188 31..1218 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:58:40 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 1..1290 2..1290 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:32:25 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 1..1290 2..1290 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:29:28 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 5..1293 1..1288 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:05:20 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 1..1290 2..1290 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:39:22 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS9-RA 5..1293 1..1288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:26:36 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7889275..7889438 1127..1290 100 <- Minus
3R 7889509..7889671 964..1126 100 <- Minus
3R 7901384..7901744 603..963 100 <- Minus
3R 7901810..7901895 517..602 100 <- Minus
3R 7902007..7902180 343..516 100 <- Minus
3R 7902239..7902454 127..342 100 <- Minus
3R 7902537..7902659 1..126 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:26:36 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7889275..7889438 1127..1290 100 <- Minus
3R 7889509..7889671 964..1126 100 <- Minus
3R 7901384..7901744 603..963 100 <- Minus
3R 7901810..7901895 517..602 100 <- Minus
3R 7902007..7902180 343..516 100 <- Minus
3R 7902239..7902454 127..342 100 <- Minus
3R 7902537..7902659 1..126 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:26:36 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7889275..7889438 1127..1290 100 <- Minus
3R 7889509..7889671 964..1126 100 <- Minus
3R 7901384..7901744 603..963 100 <- Minus
3R 7901810..7901895 517..602 100 <- Minus
3R 7902007..7902180 343..516 100 <- Minus
3R 7902239..7902454 127..342 100 <- Minus
3R 7902537..7902659 1..126 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:29:28 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3728259..3728381 1..126 97   Minus
arm_3R 3727106..3727466 603..963 100 <- Minus
arm_3R 3727532..3727617 517..602 100 <- Minus
arm_3R 3727729..3727902 343..516 100 <- Minus
arm_3R 3727961..3728176 127..342 100 <- Minus
arm_3R 3714997..3715160 1127..1290 100 <- Minus
arm_3R 3715231..3715393 964..1126 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:39:07 Download gff for RH44312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7642215..7642575 603..963 100 <- Minus
3R 7642641..7642726 517..602 100 <- Minus
3R 7642838..7643011 343..516 100 <- Minus
3R 7643070..7643285 127..342 100 <- Minus
3R 7643368..7643490 1..126 97   Minus
3R 7630106..7630269 1127..1290 100 <- Minus
3R 7630340..7630502 964..1126 100 <- Minus

RH44312.hyp Sequence

Translation from 3 to 1217

> RH44312.hyp
LFFFRKIERMALRVFGLNIVKNNRNLLQNACKSRAPMPCYMAAAPFATDV
TVQAAPAAVQKQRVSKAMRAYLKRATEHDEFMKTQHLEFQIGKRHLANMM
GADAETFTQEDIDEAISYLFPSGLYDQKARPAMKSPEVVFPARKAAEFDE
TGRPFHSMFYTGKPNFFQLLHDIVEETNKLADLEERMLRRGNKPDENQKL
EIAGFQLLPKDQLELLLVESIADIEYSNFTNSMDRLIASPYAYKSKAFIE
RYMKPLMDQSKQLEVPKPRIDEEGRQYITTYECLRKTARADVTVRLPGTG
KISINGKDISYFEDENCREQLLFPLQFSELLGKVDVEANVEGGGPSGQAG
AIRWGIAMSLRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGARRKYT
WKKR*

RH44312.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS9-PA 395 CG2957-PA 1..395 10..404 2036 100 Plus

RH44312.pep Sequence

Translation from 30 to 1217

> RH44312.pep
MALRVFGLNIVKNNRNLLQNACKSRAPMPCYMAAAPFATDVTVQAAPAAV
QKQRVSKAMRAYLKRATEHDEFMKTQHLEFQIGKRHLANMMGADAETFTQ
EDIDEAISYLFPSGLYDQKARPAMKSPEVVFPARKAAEFDETGRPFHSMF
YTGKPNFFQLLHDIVEETNKLADLEERMLRRGNKPDENQKLEIAGFQLLP
KDQLELLLVESIADIEYSNFTNSMDRLIASPYAYKSKAFIERYMKPLMDQ
SKQLEVPKPRIDEEGRQYITTYECLRKTARADVTVRLPGTGKISINGKDI
SYFEDENCREQLLFPLQFSELLGKVDVEANVEGGGPSGQAGAIRWGIAMS
LRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGARRKYTWKKR*

RH44312.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16848-PA 395 GF16848-PA 1..395 1..395 1957 91.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24884-PA 395 GG24884-PA 1..395 1..395 2032 95.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19026-PA 395 GH19026-PA 1..395 1..395 1843 85.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS9-PA 395 CG2957-PA 1..395 1..395 2036 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22839-PA 396 GI22839-PA 1..396 1..395 1856 85.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12144-PA 396 GL12144-PA 1..396 1..395 1912 89.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15542-PA 396 GA15542-PA 1..396 1..395 1912 89.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10449-PA 293 GM10449-PA 1..283 1..312 1284 80.2 Plus
Dsec\GM21042-PA 86 GM21042-PA 3..86 312..395 442 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19454-PA 395 GD19454-PA 1..395 1..395 2091 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24698-PA 396 GJ24698-PA 1..396 1..395 1824 84.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11052-PA 394 GK11052-PA 1..394 1..395 1855 85.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25764-PA 395 GE25764-PA 1..395 1..395 2040 96.5 Plus
Dyak\GE11107-PA 285 GE11107-PA 1..254 59..312 1337 97.6 Plus