Clone RH44664 Report

Search the DGRC for RH44664

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:446
Well:64
Vector:pFlc-1
Associated Gene/TranscriptCG3560-RA
Protein status:RH44664.pep: gold
Preliminary Size:445
Sequenced Size:484

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3560 2002-01-01 Sim4 clustering to Release 2
CG3560 2002-04-26 Blastp of sequenced clone
CG3560 2008-04-29 Release 5.5 accounting
CG3560 2008-08-15 Release 5.9 accounting
CG3560 2008-12-18 5.12 accounting

Clone Sequence Records

RH44664.complete Sequence

484 bp (484 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113594

> RH44664.complete
CACCTCATACCTAAAATAAAAAGGCTGGAGGAATATCTCTTTCCCGACTT
CTGATTTTACGTAAACCATGTCGAACTATATTGCCAGAAAGGGACCCGCA
GTTCTCTCAAATCTGGGCAGATGGGCCTACAATCTCTCCGGATTCAACCA
ATACGGTCTGCATCGCGATGATTGTCTGTATGAGAACGAGGATGTGAAGG
AGGCCGTGCGCCGATTGCCCAGGAAGCTGTACGATGAGCGTAACTACCGC
ATCATGAGGGCCCTCCATCTGTCCATGACCAAGACCATTCTGCCCAAGGA
GCAGTGGACCAAGTACGAGGAGGACGTCAAGTATCTGGAACCCTACCTCA
AGGAGGTCGTGAAGGAGCGCGAGGAGCGTGAGGACTGGGAAAAGATCCAC
TAAACGCGCCACTAAATCCCTCTACTTTGGACTTGTAAATGTTGAAATAC
ATAGCTTAGATAAATACCAAAAAAAAAAAAAAAA

RH44664.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG3560-RA 569 CG3560-RA 59..527 4..472 2345 100 Plus
CG32576-RA 1792 CG32576-RA 681..998 472..155 1590 100 Minus
CG17856-RA 420 CG17856-RA 3..324 67..388 650 80.1 Plus
CG32576-RA 1792 CG32576-RA 1224..1327 107..4 520 100 Minus
CG32576-RA 1792 CG32576-RA 1059..1108 157..108 250 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16176389..16176702 155..468 1555 99.7 Plus
chr3R 27901430 chr3R 24117060..24117386 62..388 660 80.1 Plus
chrX 22417052 chrX 16176060..16176163 4..107 520 100 Plus
chrX 22417052 chrX 16176279..16176328 108..157 250 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16286675..16286992 155..472 1590 100 Plus
3R 32079331 3R 28294128..28294454 62..388 660 80.1 Plus
X 23542271 X 16286346..16286449 4..107 520 100 Plus
X 23542271 X 16286565..16286614 108..157 250 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16294773..16295090 155..472 1590 100 Plus
3R 31820162 3R 28034959..28035285 62..388 660 80.1 Plus
X 23527363 X 16294444..16294547 4..107 520 100 Plus
X 23527363 X 16294663..16294712 108..157 250 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:05:21 has no hits.

RH44664.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:06:33 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16176056..16176163 1..107 97 -> Plus
chrX 16176279..16176326 108..155 100 -> Plus
chrX 16176390..16176702 156..468 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:19 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 1..336 68..403 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:48 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 1..336 68..403 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:05:47 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 1..336 68..403 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:16 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 1..336 68..403 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:56:34 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 1..336 68..403 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:46 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 1..469 3..468 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:48 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 55..523 1..468 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:05:47 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 55..523 1..468 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:16 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 1..469 3..468 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:56:34 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 55..523 1..468 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:33 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
X 16286342..16286449 1..107 97 -> Plus
X 16286565..16286612 108..155 100 -> Plus
X 16286676..16286988 156..468 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:33 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
X 16286342..16286449 1..107 97 -> Plus
X 16286565..16286612 108..155 100 -> Plus
X 16286676..16286988 156..468 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:33 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
X 16286342..16286449 1..107 97 -> Plus
X 16286565..16286612 108..155 100 -> Plus
X 16286676..16286988 156..468 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:05:47 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16180375..16180482 1..107 97 -> Plus
arm_X 16180598..16180645 108..155 100 -> Plus
arm_X 16180709..16181021 156..468 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:55 Download gff for RH44664.complete
Subject Subject Range Query Range Percent Splice Strand
X 16294774..16295086 156..468 100   Plus
X 16294440..16294547 1..107 97 -> Plus
X 16294663..16294710 108..155 100 -> Plus

RH44664.pep Sequence

Translation from 67 to 402

> RH44664.pep
MSNYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYENEDVKEAVRRL
PRKLYDERNYRIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKE
REEREDWEKIH*

RH44664.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19659-PA 111 GF19659-PA 1..109 1..109 517 85.3 Plus
Dana\GF19635-PA 111 GF19635-PA 1..111 1..111 501 93.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17947-PA 111 GG17947-PA 1..111 1..111 571 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12559-PA 111 GH12559-PA 1..111 1..111 484 89.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
UQCR-14-PA 111 CG3560-PA 1..111 1..111 598 100 Plus
UQCR-14L-PA 111 CG17856-PA 1..111 1..111 528 85.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11212-PA 111 GI11212-PA 1..111 1..111 540 91 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21337-PA 111 GL21337-PA 1..111 1..111 480 89.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17519-PA 111 GA17519-PA 1..111 1..111 477 88.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13417-PA 111 GM13417-PA 1..111 1..111 582 100 Plus
Dsec\GM16378-PA 111 GM16378-PA 1..111 1..111 516 85.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17271-PA 111 GD17271-PA 1..111 1..111 582 100 Plus
Dsim\GD21370-PA 111 GD21370-PA 1..111 1..111 516 85.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18506-PA 111 GJ18506-PA 1..111 1..111 523 88.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19174-PA 111 GK19174-PA 1..111 1..111 535 89.2 Plus
Dwil\GK25718-PA 111 GK25718-PA 1..111 1..111 486 91.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17257-PA 111 GE17257-PA 1..111 1..111 582 100 Plus
Dyak\GE23784-PA 111 GE23784-PA 1..111 1..111 512 84.7 Plus

RH44664.hyp Sequence

Translation from 67 to 402

> RH44664.hyp
MSNYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYENEDVKEAVRRL
PRKLYDERNYRIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKE
REEREDWEKIH*

RH44664.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG3560-PA 111 CG3560-PA 1..111 1..111 598 100 Plus
CG17856-PA 111 CG17856-PA 1..111 1..111 528 85.6 Plus