Clone RH44771 Report

Search the DGRC for RH44771

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:447
Well:71
Vector:pFlc-1
Associated Gene/TranscriptSdhC-RA
Protein status:RH44771.pep: gold
Preliminary Size:636
Sequenced Size:673

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6666 2001-12-17 Blastp of sequenced clone
CG6666 2002-01-01 Sim4 clustering to Release 2
CG6666 2008-04-29 Release 5.5 accounting
CG6666 2008-04-29 Stopped prior to 5.5
CG6666 2008-08-15 Release 5.9 accounting
CG6666 2008-12-18 5.12 accounting

Clone Sequence Records

RH44771.complete Sequence

673 bp (673 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071728

> RH44771.complete
GGCAGTCAGTGTACGGTCCCATCAATACAAGTTCGAGTGAAAAACAGGGA
AATGTATGCACTCTCCAGTTCTTTGATCCGCTCTCCGGCGCTGCGCCAGG
GCCTCCAGATGGCCGCTGCCAGCCGCCCGGTATCGATGAAGGTGGTTTCC
GTGGCCGAAACCCAGAAGGACGAGTCGTTCTTCGAGAAGAACGAGCGCTT
GGGCAGGGAGCTGTCGCCCCATCTGACCATCTACCAACCGCAGCTGACCT
CCATGCTCTCGATCTGTCACCGCGGCACAGGATTGGCCCTGGGTGTGGGT
GTTTGGGGTCTGGGATTGGGCGCTCTGATCTCGTCCCACGACATTAGCCA
CTATGTGACCATGGTGGAGGGCCTCCAGCTGAGTGGCGCCACTCTGACCG
CCCTCAAGTTTATCATCGCCTATCCGGCTGGCTATCACACCGCCAATGGT
ATTAGGCATCTCCTCTGGGACACCGGACGGTTCCTGAAGATCAAGGAGGT
TTACTCCACCGGTTACGCAATGGTCGCCACCTCTTTCGTGCTATCCGCTA
TCTTGGCCCTGCTCTAAGTCCAAGACCCCAGCTAAACCTATTACATTTTA
GTGCGAACACTGTGTGAAAATTGTTATATACTAAATACATGTAGTGTGTA
TATTTATAAAAAAAAAAAAAAAA

RH44771.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
SdhC.b 1186 SdhC.b 202..860 2..660 3295 100 Plus
SdhC.c 1055 SdhC.c 150..808 2..660 3295 100 Plus
SdhC-RA 1055 SdhC-RA 150..808 2..660 3295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7034720..7035323 657..54 3005 99.8 Minus
chr3R 27901430 chr3R 7035378..7035432 56..2 275 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11209134..11209740 660..54 3035 100 Minus
3R 32079331 3R 11209795..11209849 56..2 275 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10949965..10950571 660..54 3035 100 Minus
3R 31820162 3R 10950626..10950680 56..2 275 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:25:45 has no hits.

RH44771.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:26:40 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7034720..7035323 54..657 99 <- Minus
chr3R 7035381..7035432 1..53 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:21 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
CG6666-RA 1..516 52..567 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:46:30 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
SdhC-RA 1..516 52..567 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:29:38 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
SdhC-RA 1..516 52..567 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:14:43 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
CG6666-RA 1..516 52..567 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:39:32 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
SdhC-RA 1..516 52..567 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:10:48 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
CG6666-RA 1..656 2..657 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:46:30 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
SdhC-RA 1..656 2..657 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:29:38 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
SdhC-RA 1..656 2..657 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:14:44 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
CG6666-RA 1..656 2..657 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:39:32 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
SdhC-RA 1..656 2..657 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:26:40 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11209137..11209740 54..657 100 <- Minus
3R 11209798..11209849 1..53 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:26:40 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11209137..11209740 54..657 100 <- Minus
3R 11209798..11209849 1..53 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:26:40 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11209137..11209740 54..657 100 <- Minus
3R 11209798..11209849 1..53 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:29:38 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7034859..7035462 54..657 100 <- Minus
arm_3R 7035520..7035571 1..53 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:48:27 Download gff for RH44771.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10949968..10950571 54..657 100 <- Minus
3R 10950629..10950680 1..53 98   Minus

RH44771.hyp Sequence

Translation from 3 to 566

> RH44771.hyp
SQCTVPSIQVRVKNREMYALSSSLIRSPALRQGLQMAAASRPVSMKVVSV
AETQKDESFFEKNERLGRELSPHLTIYQPQLTSMLSICHRGTGLALGVGV
WGLGLGALISSHDISHYVTMVEGLQLSGATLTALKFIIAYPAGYHTANGI
RHLLWDTGRFLKIKEVYSTGYAMVATSFVLSAILALL*

RH44771.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
SdhC-PB 171 CG6666-PB 1..171 17..187 857 100 Plus
SdhC-PA 171 CG6666-PA 1..171 17..187 857 100 Plus
CG6629-PA 261 CG6629-PA 59..199 42..184 265 41.3 Plus

RH44771.pep Sequence

Translation from 51 to 566

> RH44771.pep
MYALSSSLIRSPALRQGLQMAAASRPVSMKVVSVAETQKDESFFEKNERL
GRELSPHLTIYQPQLTSMLSICHRGTGLALGVGVWGLGLGALISSHDISH
YVTMVEGLQLSGATLTALKFIIAYPAGYHTANGIRHLLWDTGRFLKIKEV
YSTGYAMVATSFVLSAILALL*

RH44771.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18258-PA 152 GF18258-PA 1..152 20..171 716 88.8 Plus
Dana\GF18264-PA 281 GF18264-PA 80..217 26..165 268 41.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17240-PA 152 GG17240-PA 1..152 20..171 787 98.7 Plus
Dere\GG17249-PA 269 GG17249-PA 59..199 26..168 287 43.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19420-PA 171 GH19420-PA 1..171 1..171 798 88.3 Plus
Dgri\GH19425-PA 170 GH19425-PA 6..135 39..168 295 46.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
SdhC-PB 171 CG6666-PB 1..171 1..171 857 100 Plus
SdhC-PA 171 CG6666-PA 1..171 1..171 857 100 Plus
CG6629-PA 261 CG6629-PA 59..199 26..168 265 41.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22625-PA 152 GI22625-PA 1..152 20..171 680 81.6 Plus
Dmoj\GI22631-PA 229 GI22631-PA 36..163 34..161 309 49.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12041-PA 152 GL12041-PA 1..152 20..171 703 86.8 Plus
Dper\GL12050-PA 307 GL12050-PA 106..235 42..171 266 40.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19764-PB 171 GA19764-PB 1..171 1..171 790 87.1 Plus
Dpse\GA27966-PA 235 GA27966-PA 34..163 42..171 271 41.5 Plus
Dpse\GA26173-PA 332 GA26173-PA 131..260 42..171 268 40.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26120-PA 171 GM26120-PA 1..171 1..171 888 100 Plus
Dsec\GM26134-PA 264 GM26134-PA 59..199 26..168 275 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20679-PA 152 GD20679-PA 1..152 20..171 795 100 Plus
Dsim\GD20687-PA 262 GD20687-PA 56..196 26..168 270 40.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23871-PA 170 GJ23871-PA 1..170 2..171 769 84.7 Plus
Dvir\GJ23876-PA 269 GJ23876-PA 90..217 42..169 289 42.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13274-PA 174 GK13274-PA 6..174 2..171 728 81.8 Plus
Dwil\GK13994-PA 230 GK13994-PA 5..146 26..168 254 37.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24640-PA 171 GE24640-PA 1..171 1..171 884 99.4 Plus
Dyak\GE24651-PA 265 GE24651-PA 59..199 26..168 279 42.7 Plus