Clone RH44935 Report

Search the DGRC for RH44935

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:449
Well:35
Vector:pFlc-1
Associated Gene/TranscriptCG11752-RA
Protein status:RH44935.pep: gold
Preliminary Size:447
Sequenced Size:466

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11752 2002-01-01 Sim4 clustering to Release 2
CG11752 2002-06-11 Blastp of sequenced clone
CG11752 2003-01-01 Sim4 clustering to Release 3
CG11752 2008-04-29 Release 5.5 accounting
CG11752 2008-08-15 Release 5.9 accounting
CG11752 2008-12-18 5.12 accounting

Clone Sequence Records

RH44935.complete Sequence

466 bp (466 high quality bases) assembled on 2002-06-11

GenBank Submission: AY071731

> RH44935.complete
GGTTGATACGTGATTACGTGAATTATTTTTGCGAATTAAACGCTGCAAGC
TAGCCAGCCATTAAGTCCAACATGTTCTCGCCCTCACGTGCCCTGCGCCC
AGCCCTCAGCCGCTGCTACAGCCAGATCAAGGGCGGACCCGTTTCCGGCG
GCGGTAGACCCAGCGCCTCAGGATCTCCAGCTGGAGCCGGATCCTCGCCA
TCGGGCGGCGCATCCTCGCCATCGGTTGTGGGACTGACCAGCAATTGCGT
GAAGCCCAGCAGCGGACCCGTTGGACCAGGTGCCTCCGCCACCGGTGGCT
ACAAGGTGCCTGAATACTACAGCTTCAATCGCTTTAGCTACGCCGAGGCG
GAGGTGGAAATGGCCAAGTACCGCTGCCCACAGCCCTCGGCCCTCAAGTA
GATGTAGCCCAATTGTTGATGTTAAATAAAATAAATGCCATTTAAAGAGG
AAAAAAAAAAAAAAAA

RH44935.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG11752-RA 496 CG11752-RA 28..477 2..451 2250 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11241170..11241618 2..450 2245 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11350026..11350475 2..451 2250 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11358124..11358573 2..451 2250 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:33:56 has no hits.

RH44935.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:34:37 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11241169..11241618 1..450 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:27 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 1..330 72..401 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:33 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 1..330 72..401 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:15:54 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 1..330 72..401 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:30 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 1..330 72..401 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:24:15 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 1..330 72..401 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:42 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 27..476 1..450 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:33 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 27..476 1..450 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:15:54 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 28..477 1..450 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:30 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 27..476 1..450 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:24:15 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 28..477 1..450 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:37 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
X 11350025..11350474 1..450 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:37 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
X 11350025..11350474 1..450 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:37 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
X 11350025..11350474 1..450 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:15:54 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11244058..11244507 1..450 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:47 Download gff for RH44935.complete
Subject Subject Range Query Range Percent Splice Strand
X 11358123..11358572 1..450 99   Plus

RH44935.pep Sequence

Translation from 71 to 400

> RH44935.pep
MFSPSRALRPALSRCYSQIKGGPVSGGGRPSASGSPAGAGSSPSGGASSP
SVVGLTSNCVKPSSGPVGPGASATGGYKVPEYYSFNRFSYAEAEVEMAKY
RCPQPSALK*

RH44935.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21766-PA 108 GF21766-PA 1..107 1..109 351 76.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18406-PA 109 GG18406-PA 1..109 1..109 422 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12179-PA 104 GH12179-PA 8..103 7..109 281 54.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG11752-PA 109 CG11752-PA 1..109 1..109 571 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15709-PA 110 GI15709-PA 4..108 3..109 264 56.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14849-PA 99 GL14849-PA 1..98 1..109 334 66.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11174-PA 99 GA11174-PA 1..98 1..109 339 67.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11472-PA 107 GM11472-PA 1..107 1..109 429 88.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17015-PA 107 GD17015-PA 1..107 1..109 491 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15237-PA 105 GJ15237-PA 4..105 3..109 280 62.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18845-PA 100 GK18845-PA 2..99 5..109 341 69.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15925-PA 102 GE15925-PA 1..102 1..109 465 89 Plus

RH44935.hyp Sequence

Translation from 71 to 400

> RH44935.hyp
MFSPSRALRPALSRCYSQIKGGPVSGGGRPSASGSPAGAGSSPSGGASSP
SVVGLTSNCVKPSSGPVGPGASATGGYKVPEYYSFNRFSYAEAEVEMAKY
RCPQPSALK*

RH44935.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG11752-PA 109 CG11752-PA 1..109 1..109 571 100 Plus