Clone RH45008 Report

Search the DGRC for RH45008

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:450
Well:8
Vector:pFlc-1
Associated Gene/TranscriptCG9034-RA
Protein status:RH45008.pep: gold
Preliminary Size:368
Sequenced Size:430

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9034 2001-12-17 Blastp of sequenced clone
CG9034 2002-01-01 Sim4 clustering to Release 2
CG9034 2003-01-01 Sim4 clustering to Release 3
CG9034 2008-04-29 Release 5.5 accounting
CG9034 2008-08-15 Release 5.9 accounting
CG9034 2008-12-18 5.12 accounting

Clone Sequence Records

RH45008.complete Sequence

430 bp (430 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071733

> RH45008.complete
GCTCGATAGCCAGCAGGCCAGCTCTAATCAGCTGTTTGGTTTGTTCGTTG
TGTAACTTAACTGAACGCGTTGAATTTTTGTGTACCAAGATGTCCGCATC
CGCTGCCCGAGGCTCCACATCGCTGCTGAAGCGCGCCTGGAACGAGATTC
CGGACATCGTCGGCGGATCCGCTTTGGCCCTCGCCGGAATCGTTATGGCC
ACCATCGGAGTGGCCAACTACTATGCCAAGGACGGCGATAACCGACGCTA
CAAGCTCGGCTACGTTGTCTACCGCCACGACGATCCGCGCGCCCTGAAGG
TGCGCAACGACGAGGATGACTAGAGGAGTTGGACCCTTCGGAAAAATCCT
GTCGGCTTTCATCTTTGATTTTTTTTTGTTTACTCTAAAGCTAAGTAAAA
CAAACATCCAAATGTAAAAAAAAAAAAAAA

RH45008.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-RA 611 CG9034-RA 114..532 3..421 2080 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9051315..9051650 415..80 1680 100 Minus
chrX 22417052 chrX 9051710..9051787 80..3 390 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9159508..9159849 421..80 1695 99.7 Minus
X 23542271 X 9159907..9159984 80..3 390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9167606..9167947 421..80 1695 99.7 Minus
X 23527363 X 9168005..9168082 80..3 390 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:37:28 has no hits.

RH45008.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:38:36 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9051315..9051649 81..415 100 <- Minus
chrX 9051710..9051787 1..80 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:31 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 1..234 90..323 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:29:27 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 1..234 90..323 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:27:19 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 1..234 90..323 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:13 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 1..234 90..323 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:39 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 1..234 90..323 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:23:32 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 2..414 3..415 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:29:27 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 2..414 3..415 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:27:19 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RB 66..481 1..415 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:14 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 2..414 3..415 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:39 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RB 66..481 1..415 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:36 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
X 9159514..9159848 81..415 100 <- Minus
X 9159907..9159984 1..80 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:36 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
X 9159514..9159848 81..415 100 <- Minus
X 9159907..9159984 1..80 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:36 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
X 9159514..9159848 81..415 100 <- Minus
X 9159907..9159984 1..80 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:27:19 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9053940..9054017 1..80 97   Minus
arm_X 9053547..9053881 81..415 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:53:21 Download gff for RH45008.complete
Subject Subject Range Query Range Percent Splice Strand
X 9167612..9167946 81..415 100 <- Minus
X 9168005..9168082 1..80 97   Minus

RH45008.hyp Sequence

Translation from 2 to 322

> RH45008.hyp
SIASRPALISCLVCSLCNLTERVEFLCTKMSASAARGSTSLLKRAWNEIP
DIVGGSALALAGIVMATIGVANYYAKDGDNRRYKLGYVVYRHDDPRALKV
RNDEDD*

RH45008.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-PB 77 CG9034-PB 1..77 30..106 395 100 Plus
CG9034-PA 77 CG9034-PA 1..77 30..106 395 100 Plus

RH45008.pep Sequence

Translation from 89 to 322

> RH45008.pep
MSASAARGSTSLLKRAWNEIPDIVGGSALALAGIVMATIGVANYYAKDGD
NRRYKLGYVVYRHDDPRALKVRNDEDD*

RH45008.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19215-PA 77 GF19215-PA 1..77 1..77 364 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18998-PA 77 GG18998-PA 1..77 1..77 378 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17746-PA 77 GH17746-PA 1..77 1..77 333 83.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-PB 77 CG9034-PB 1..77 1..77 395 100 Plus
CG9034-PA 77 CG9034-PA 1..77 1..77 395 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15501-PA 77 GI15501-PA 1..77 1..77 347 83.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26829-PA 77 GL26829-PA 1..77 1..77 358 89.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21494-PA 77 GA21494-PA 1..77 1..77 358 89.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13674-PA 77 GM13674-PA 1..77 1..77 390 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16080-PA 77 GD16080-PA 1..77 1..77 388 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19260-PA 105 GJ19260-PA 29..105 1..77 344 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25215-PA 77 GK25215-PA 1..77 1..77 356 88.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17410-PA 77 GE17410-PA 1..77 1..77 378 96.1 Plus