BDGP Sequence Production Resources |
Search the DGRC for RH45008
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 450 |
Well: | 8 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG9034-RA |
Protein status: | RH45008.pep: gold |
Preliminary Size: | 368 |
Sequenced Size: | 430 |
Gene | Date | Evidence |
---|---|---|
CG9034 | 2001-12-17 | Blastp of sequenced clone |
CG9034 | 2002-01-01 | Sim4 clustering to Release 2 |
CG9034 | 2003-01-01 | Sim4 clustering to Release 3 |
CG9034 | 2008-04-29 | Release 5.5 accounting |
CG9034 | 2008-08-15 | Release 5.9 accounting |
CG9034 | 2008-12-18 | 5.12 accounting |
430 bp (430 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071733
> RH45008.complete GCTCGATAGCCAGCAGGCCAGCTCTAATCAGCTGTTTGGTTTGTTCGTTG TGTAACTTAACTGAACGCGTTGAATTTTTGTGTACCAAGATGTCCGCATC CGCTGCCCGAGGCTCCACATCGCTGCTGAAGCGCGCCTGGAACGAGATTC CGGACATCGTCGGCGGATCCGCTTTGGCCCTCGCCGGAATCGTTATGGCC ACCATCGGAGTGGCCAACTACTATGCCAAGGACGGCGATAACCGACGCTA CAAGCTCGGCTACGTTGTCTACCGCCACGACGATCCGCGCGCCCTGAAGG TGCGCAACGACGAGGATGACTAGAGGAGTTGGACCCTTCGGAAAAATCCT GTCGGCTTTCATCTTTGATTTTTTTTTGTTTACTCTAAAGCTAAGTAAAA CAAACATCCAAATGTAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9034-RA | 611 | CG9034-RA | 114..532 | 3..421 | 2080 | 99.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 9051315..9051649 | 81..415 | 100 | <- | Minus |
chrX | 9051710..9051787 | 1..80 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RA | 1..234 | 90..323 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RA | 1..234 | 90..323 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RA | 1..234 | 90..323 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RA | 1..234 | 90..323 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RA | 1..234 | 90..323 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RA | 2..414 | 3..415 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RA | 2..414 | 3..415 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RB | 66..481 | 1..415 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RA | 2..414 | 3..415 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9034-RB | 66..481 | 1..415 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9159514..9159848 | 81..415 | 100 | <- | Minus |
X | 9159907..9159984 | 1..80 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9159514..9159848 | 81..415 | 100 | <- | Minus |
X | 9159907..9159984 | 1..80 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9159514..9159848 | 81..415 | 100 | <- | Minus |
X | 9159907..9159984 | 1..80 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 9053940..9054017 | 1..80 | 97 | Minus | |
arm_X | 9053547..9053881 | 81..415 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9167612..9167946 | 81..415 | 100 | <- | Minus |
X | 9168005..9168082 | 1..80 | 97 | Minus |
Translation from 2 to 322
> RH45008.hyp SIASRPALISCLVCSLCNLTERVEFLCTKMSASAARGSTSLLKRAWNEIP DIVGGSALALAGIVMATIGVANYYAKDGDNRRYKLGYVVYRHDDPRALKV RNDEDD*
Translation from 89 to 322
> RH45008.pep MSASAARGSTSLLKRAWNEIPDIVGGSALALAGIVMATIGVANYYAKDGD NRRYKLGYVVYRHDDPRALKVRNDEDD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19215-PA | 77 | GF19215-PA | 1..77 | 1..77 | 364 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18998-PA | 77 | GG18998-PA | 1..77 | 1..77 | 378 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17746-PA | 77 | GH17746-PA | 1..77 | 1..77 | 333 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9034-PB | 77 | CG9034-PB | 1..77 | 1..77 | 395 | 100 | Plus |
CG9034-PA | 77 | CG9034-PA | 1..77 | 1..77 | 395 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15501-PA | 77 | GI15501-PA | 1..77 | 1..77 | 347 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26829-PA | 77 | GL26829-PA | 1..77 | 1..77 | 358 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21494-PA | 77 | GA21494-PA | 1..77 | 1..77 | 358 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13674-PA | 77 | GM13674-PA | 1..77 | 1..77 | 390 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16080-PA | 77 | GD16080-PA | 1..77 | 1..77 | 388 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19260-PA | 105 | GJ19260-PA | 29..105 | 1..77 | 344 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25215-PA | 77 | GK25215-PA | 1..77 | 1..77 | 356 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17410-PA | 77 | GE17410-PA | 1..77 | 1..77 | 378 | 96.1 | Plus |