Clone RH45712 Report

Search the DGRC for RH45712

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:457
Well:12
Vector:pFlc-1
Associated Gene/TranscriptCG14109-RA
Protein status:RH45712.pep: gold
Sequenced Size:894

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14109 2008-04-29 Release 5.5 accounting
CG14109 2008-04-29 Picked prior to 5.5
CG14109 2008-08-15 Release 5.9 accounting
CG14109 2008-12-18 5.12 accounting

Clone Sequence Records

RH45712.complete Sequence

894 bp assembled on 2007-09-25

GenBank Submission: BT031024

> RH45712.complete
GATTCCCTCTGCTCCTCAGGAACCCAGAAAATGGTCAACGAACTGAATAG
GCCTCAAAATGGGGACAATGCCGCCTTGAGCGAGCGCCTAGCTGCTTCCA
ACAGACAGCTGCAAGAGATGCAGGAGGAGCACCGCCAGTTGCTTGAGGAG
ATGGAGACACTGCGCTTACGAGCCGCTGAGCTGACCCTTCTGAATGCCCA
GCGCCGACAAGTGCGGCAGTCCACCGAGGAGGAGGAGGTTCAGTCCCACG
TTGAATCCTCATCGGAGACAGTAACAGTTGCTTCGTCCGCCAGTGCTTCT
GGAGAGTTCACAAACCGGGAAGAGGCACCATCTGGTGAGGAAGAGGGCGG
GGAGGACAAAGAGGAGCAGGCCAGTTATCTGCAGGAGAAGCTAAACGAGA
TCGCCAACCTGAAGGCGCAGTTTAAGCGCGTGCAGAACATGGTGGACACC
ACCAAGATGATCGAGGAGCACATGTCCTCCAGGCAAACGGTACAGGTCCA
GAGCTCCACCTCCGTTCAGACCAGCAGGCAGACCACCTCGTCAGAAGTCC
GAGTGGCCAGCGAGGCCGTAGAGAGTGCCCAAGAAGAGAATCCATCGACC
TCGTCGAGTGCTCCCGATAACGCCGAGCTCCTGAATTCCATGCTTAACAT
GTTCACGGACTTCACCAGTGATCTACGCGGTCAAGCGGTGGGACTCCGGG
CGGAGAGGGATCGGATTCGTGCGCTCAAGGAGGACATCATCCAGCGCAAG
CAGGGAAAGTAGGCACGTCCAAACTTGAAAGGGAAAATGGCTCTAGTCAT
ATAATGTTTATTATCCAAGGAACATATTATAAAGTAATCTCCAAATAAAT
AATTATCCTTAAAAGATATCAAATTACCAAAAAAAAAAAAAAAA

RH45712.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG14109-RA 938 CG14109-RA 24..902 2..880 4365 99.7 Plus
CG14109.c 988 CG14109.c 90..952 18..880 4300 99.8 Plus
CG14109.a 932 CG14109.a 70..930 20..880 4290 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13431854..13432649 83..878 3695 97.6 Plus
chr3L 24539361 chr3L 13431422..13431504 2..84 385 97.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13441625..13442422 83..880 3975 99.9 Plus
3L 28110227 3L 13441197..13441279 2..84 400 98.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13434725..13435522 83..880 3975 99.8 Plus
3L 28103327 3L 13434297..13434379 2..84 400 98.7 Plus
Blast to na_te.dros performed on 2019-03-15 15:12:47 has no hits.

RH45712.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:13:49 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13431420..13431504 1..84 96 -> Plus
chr3L 13431856..13432649 85..878 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:42 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..732 31..762 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:01 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..732 31..762 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:07:12 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..732 31..762 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:16 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..732 31..762 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:31:22 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..732 31..762 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:03:20 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..763 1..762 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:00 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..877 2..878 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:07:12 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..877 2..878 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:16 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..763 1..762 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:31:22 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
CG14109-RA 1..877 2..878 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:13:49 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13441195..13441279 1..84 97 -> Plus
3L 13441627..13442420 85..878 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:13:49 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13441195..13441279 1..84 97 -> Plus
3L 13441627..13442420 85..878 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:13:49 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13441195..13441279 1..84 97 -> Plus
3L 13441627..13442420 85..878 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:07:12 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13434727..13435520 85..878 99   Plus
arm_3L 13434295..13434379 1..84 97 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:18 Download gff for RH45712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13434727..13435520 85..878 99   Plus
3L 13434295..13434379 1..84 97 -> Plus

RH45712.hyp Sequence

Translation from 0 to 761

> RH45712.hyp
YSLFSSGTQKMVNELNRPQNGDNAALSERLAASNRQLQEMQEEHRQLLEE
METLRLRAAELTLLNAQRRQVRQSTEEEEVQSHVESSSETVTVASSASAS
GEFTNREEAPSGEEEGGEDKEEQASYLQEKLNEIANLKAQFKRVQNMVDT
TKMIEEHMSSRQTVQVQSSTSVQTSRQTTSSEVRVASEAVESAQEENPST
SSSAPDNAELLNSMLNMFTDFTSDLRGQAVGLRAERDRIRALKEDIIQRK
QGK*

RH45712.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14109-PB 243 CG14109-PB 1..243 11..253 1177 100 Plus
CG14109-PA 243 CG14109-PA 1..243 11..253 1177 100 Plus

RH45712.pep Sequence

Translation from 30 to 761

> RH45712.pep
MVNELNRPQNGDNAALSERLAASNRQLQEMQEEHRQLLEEMETLRLRAAE
LTLLNAQRRQVRQSTEEEEVQSHVESSSETVTVASSASASGEFTNREEAP
SGEEEGGEDKEEQASYLQEKLNEIANLKAQFKRVQNMVDTTKMIEEHMSS
RQTVQVQSSTSVQTSRQTTSSEVRVASEAVESAQEENPSTSSSAPDNAEL
LNSMLNMFTDFTSDLRGQAVGLRAERDRIRALKEDIIQRKQGK*

RH45712.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23485-PA 249 GF23485-PA 1..249 1..243 708 65.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15644-PA 245 GG15644-PA 1..245 1..243 974 88.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16898-PA 245 GH16898-PA 1..245 1..243 530 54.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14109-PB 243 CG14109-PB 1..243 1..243 1177 100 Plus
CG14109-PA 243 CG14109-PA 1..243 1..243 1177 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11515-PA 235 GI11515-PA 1..235 1..243 526 56.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25446-PA 247 GL25446-PA 1..247 1..243 725 65.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12764-PA 247 GA12764-PA 1..247 1..243 734 65.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25420-PA 243 GM25420-PA 1..243 1..243 1058 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14450-PA 243 GD14450-PA 1..243 1..243 1098 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11770-PA 244 GJ11770-PA 1..244 1..243 550 56.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17085-PA 262 GK17085-PA 1..262 1..243 609 56.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21971-PA 247 GE21971-PA 1..247 1..243 982 87 Plus